Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
23-044 R&S Construction Management, Inc. for work on the 2023 Concrete Reconstruction Project
2023 Concrete Reconstruction Project 2021 Form CONTRACT 2023-104 Page 1 Contract This public works contract (“Contract”) is entered into by and between City of Cupertino (“City”) and R&S Construction Management, Inc. (“Contractor”), for work on the 2023 Concrete Reconstruction Project (“Project”). The parties agree as follows: 1.Award of Contract. In response to the Notice Inviting Bids, Contractor has submitted a Bid Proposal to perform the Work to construct the Project. On May 2, 2023, City authorized award of this Contract to Contractor for the amount set forth in Section 4, below. 2.Contract Documents. The Contract Documents incorporated into this Contract include and are comprised of all of the documents listed below. The definitions provided in Article 1 of the General Conditions apply to all of the Contract Documents, including this Contract. 2.1 Notice Inviting Bids; 2.2 Instructions to Bidders; 2.3 Addenda, if any; 2.4 Bid Proposal and attachments thereto; 2.5 Contract; 2.6 Payment and Performance Bonds; 2.7 General Conditions; 2.8 Special Conditions; 2.9 Project Plans and Specifications; 2.10 Change Orders, if any; 2.11 Notice of Potential Award; 2.12 Notice to Proceed; and 2.13 The following: Traffic Control Specifications, City Standard Details, Caltrans Standard Details, Truck Traffic Restriction Map 3.Contractor’s Obligations. Contractor will perform all of the Work required for the Project, as specified in the Contract Documents. Contractor must provide, furnish, and supply all things necessary and incidental for the timely performance and completion of the Work, including all necessary labor, materials, supplies, tools, equipment, transportation, onsite facilities, and utilities, unless otherwise specified in the Contract Documents. Contractor must use its best efforts to diligently prosecute and complete the Work in a professional and expeditious manner and to meet or exceed the performance standards required by the Contract Documents. Contractor agrees to carry out its work in compliance with any applicable local, State or Federal order regarding COVID-19. 4.Payment. As full and complete compensation for Contractor’s timely performance and completion of the Work in strict accordance with the terms and conditions of the Contract Documents, City will pay Contractor $1,378,793.40 (“Contract Price”) for all of Contractor’s direct and indirect costs to perform the Work, including all labor, materials, supplies, equipment, taxes, insurance, bonds and all overhead costs, in accordance with the payment provisions in the General Conditions. 5.Time for Completion. Contractor will fully complete the Work for the Project, meeting all requirements for Final Completion, within 145 calendar days from the commencement date given in the Notice to Proceed (“Contract Time”). All curb and gutter and curb ramp improvements on streets to be paved in 2023 must be complete by June 20, 2023. By signing below, Contractor expressly waives any claim for delayed early completion. 2023 Concrete Reconstruction Project 2021 Form CONTRACT 2023-104 Page 2 6. Liquidated Damages. If Contractor fails to complete the Work within the Contract Time, City will assess liquidated damages in the amount of $1,000 per day for each day of unexcused delay in achieving Final Completion, and such liquidated damages may be deducted from City’s payments due or to become due to Contractor under this Contract. 7. Labor Code Compliance. 7.1 General. This Contract is subject to all applicable requirements of Chapter 1 of Part 7 of Division 2 of the Labor Code, including requirements pertaining to wages, working hours and workers’ compensation insurance, as further specified in Article 9 of the General Conditions. 7.2 Prevailing Wages. This Project is subject to the prevailing wage requirements applicable to the locality in which the Work is to be performed for each craft, classification or type of worker needed to perform the Work, including employer payments for health and welfare, pension, vacation, apprenticeship and similar purposes. Copies of these prevailing rates are available online at http://www.dir.ca.gov/DLSR. 7.3 DIR Registration. City may not enter into the Contract with a bidder without proof that the bidder and its Subcontractors are registered with the California Department of Industrial Relations to perform public work pursuant to Labor Code § 1725.5, subject to limited legal exceptions. 8. Workers’ Compensation Certification. Pursuant to Labor Code § 1861, by signing this Contract, Contractor certifies as follows: “I am aware of the provisions of Labor Code § 3700 which require every employer to be insured against liability for workers’ compensation or to undertake self-insurance in accordance with the provisions of that code, and I will comply with such provisions before commencing the performance of the Work on this Contract.” 9. Conflicts of Interest. Contractor, its employees, Subcontractors and agents, may not have, maintain or acquire a conflict of interest in relation to this Contract in violation of any City ordinance or requirement, or in violation of any California law, including Government Code § 1090 et seq., or the Political Reform Act, as set forth in Government Code § 81000 et seq. and its accompanying regulations. Any violation of this Section constitutes a material breach of the Contract. 10. Independent Contractor. Contractor is an independent contractor under this Contract and will have control of the Work and the means and methods by which it is performed. Contractor and its Subcontractors are not employees of City and are not entitled to participate in any health, retirement, or any other employee benefits from City. 11. Notice. Any notice, billing, or payment required by or pursuant to the Contract Documents must be made in writing, signed, dated and sent to the other party by personal delivery, U.S. Mail, a reliable overnight delivery service, or by email as a PDF file. Notice is deemed effective upon delivery, except that service by U.S. Mail is deemed effective on the second working day after deposit for delivery. Notice for each party must be given as follows: City: Department of Public Works 10300 Torre Ave Cupertino, CA 95014 Attn: Jo Anne Johnson 2023 Concrete Reconstruction Project 2021 Form CONTRACT 2023-104 Page 3 joannej@cupertino.org Copy to: PWInvoices Pwinvoices@cupertino.org Contractor: Name:_____________________________________ Address:___________________________________ City/State/Zip:_______________________________ Phone:_____________________________________ Attn:_______________________________________ Email:______________________________________ Copy to:____________________________________ 12.General Provisions. 12.1 Assignment and Successors. Contractor may not assign its rights or obligations under this Contract, in part or in whole, without City’s written consent. This Contract is binding on Contractor’s and City’s lawful heirs, successors and permitted assigns. 12.2 Third Party Beneficiaries. There are no intended third party beneficiaries to this Contract. 12.3 Governing Law and Venue. This Contract will be governed by California law and venue will be in the Santa Clara County Superior Court, and no other place. Contractor waives any right it may have pursuant to Code of Civil Procedure § 394, to file a motion to transfer any action arising from or relating to this Contract to a venue outside of Santa Clara County, California. 12.4 Amendment. No amendment or modification of this Contract will be binding unless it is in a writing duly authorized and signed by the parties to this Contract. 12.5 Integration. This Contract and the Contract Documents incorporated herein, including authorized amendments or Change Orders thereto, constitute the final, complete, and exclusive terms of the agreement between City and Contractor. 12.6 Severability. If any provision of the Contract Documents is determined to be illegal, invalid, or unenforceable, in whole or in part, the remaining provisions of the Contract Documents will remain in full force and effect. 12.7 Iran Contracting Act. If the Contract Price exceeds $1,000,000, Contractor certifies, by signing below, that it is not identified on a list created under the Iran Contracting Act, Public Contract Code § 2200 et seq. (the “Act”), as a person engaging in investment activities in Iran, as defined in the Act, or is otherwise expressly exempt under the Act. 12.8 Authorization. Each individual signing below warrants that he or she is authorized to do so by the party that he or she represents, and that this Contract is legally binding on that party. If Contractor is a corporation, signatures from two officers of the corporation are required pursuant to California Corporation Code § 313. R&S Construction Management Inc. 1555 Burke Ave, Suite 1 San Francisco, CA 94124 415-872-9935 Teera Nuntaworanuchteera@rscminc.com 2023 Concrete Reconstruction Project 2021 Form CONTRACT 2023-104 Page 4 The parties agree to this Contract as witnessed by the signatures below: CITY: Approved as to form: s/_______________________________ s/__________________________________ ________________________________ ___________________________________ Name, Title Name, Title Date: ___________________________ Date: ______________________________ Attest: s/_______________________________ _________________________________ Name, Title Date: ___________________________ CONTRACTOR: ___________________________________________________ Business Name s/_______________________________ _________________________________ Name, Title Date: ____________________________ Second Signature (See Section 12.8): s/_______________________________ _________________________________ Name, Title Date: ____________________________ ___________________________________________________ Contractor’s California License Number(s) and Expiration Date(s) END OF CONTRACT Matt Ramirez President May 30, 2023 R&S Construction Management Inc. 992019 04/30/2024 Teera Nuntaworanuch Vice President May 30, 2023 Christopher D. Jensen Christopher D. Jensen City Attorney May 30, 2023 Pamela Wu City Manager May 31, 2023 Kirsten Squarcia City Clerk May 31, 2023 AB C D Ho l d e r I d e n t i f i e r : 77 7 7 7 7 7 7 0 7 0 7 0 7 0 0 0 7 7 7 6 3 6 1 6 0 6 5 5 5 3 3 3 0 7 6 2 7 1 6 4 4 6 2 0 5 4 5 7 7 0 7 4 5 3 1 3 6 7 6 2 4 0 6 2 1 0 0 7 3 7 5 0 5 7 6 0 5 7 3 3 1 0 3 0 7 2 6 1 5 0 0 0 2 0 7 2 0 1 1 3 0 7 5 2 2 4 1 5 7 3 2 6 7 4 1 1 2 0 7 5 2 6 2 3 3 5 7 6 0 7 6 7 7 0 0 7 7 2 2 4 1 1 1 7 6 0 1 2 7 5 6 0 7 7 4 4 0 1 5 3 5 0 2 7 6 5 5 2 0 7 7 7 2 7 2 5 2 0 2 5 7 7 3 1 1 0 7 7 7 7 7 7 7 0 7 0 0 0 7 0 7 0 0 7 66 6 6 6 6 6 6 0 6 0 6 0 6 0 0 0 6 2 6 0 6 4 6 6 2 0 4 4 4 6 2 0 0 6 2 0 2 0 0 6 2 6 0 2 4 0 0 0 0 0 6 2 2 2 0 2 4 0 4 2 0 6 0 0 0 0 0 6 2 2 0 0 0 4 2 4 2 2 6 0 2 2 0 0 6 2 2 2 2 0 4 2 6 0 0 4 0 2 0 2 0 6 0 2 2 2 0 6 2 6 2 2 6 0 0 2 0 0 6 2 2 2 0 2 6 0 4 2 2 4 0 2 0 0 0 6 0 0 0 2 2 4 0 6 0 2 6 2 2 2 2 0 6 0 2 2 0 2 6 2 6 2 2 0 2 6 0 0 0 6 6 6 4 6 0 6 2 2 4 0 6 6 4 4 4 0 6 6 6 6 6 6 6 0 6 0 0 0 6 0 6 0 0 6 Ce r t i f i c a t e N o : 5 7 0 0 9 9 3 6 6 0 7 0 CERTIFICATE OF LIABILITY INSURANCE DATE(MM/DD/YYYY) 05/09/2023 IMPORTANT: If the certificate holder is an ADDITIONAL INSURED, the policy(ies) must have ADDITIONAL INSURED provisions or be endorsed. If SUBROGATION IS WAIVED, subject to the terms and conditions of the policy, certain policies may require an endorsement. A statement on this certificate does not confer rights to the certificate holder in lieu of such endorsement(s). THIS CERTIFICATE IS ISSUED AS A MATTER OF INFORMATION ONLY AND CONFERS NO RIGHTS UPON THE CERTIFICATE HOLDER. THIS CERTIFICATE DOES NOT AFFIRMATIVELY OR NEGATIVELY AMEND, EXTEND OR ALTER THE COVERAGE AFFORDED BY THE POLICIES BELOW. THIS CERTIFICATE OF INSURANCE DOES NOT CONSTITUTE A CONTRACT BETWEEN THE ISSUING INSURER(S), AUTHORIZED REPRESENTATIVE OR PRODUCER, AND THE CERTIFICATE HOLDER. PRODUCER Aon Risk Insurance Services West, Inc. San Francisco CA Office 425 Market Street Suite 2800 San Francisco CA 94105 USA PHONE (A/C. No. Ext): E-MAIL ADDRESS: INSURER(S) AFFORDING COVERAGE NAIC # (866) 283-7122 INSURED 25682The Travelers Indemnity Co of CTINSURER A: 25674Travelers Property Cas Co of AmericaINSURER B: 30481St. Paul Surplus Lines Ins CoINSURER C: INSURER D: INSURER E: INSURER F: FAX (A/C. No.):(800) 363-0105 CONTACT NAME: R&S Construction Management, Inc. 1555 Burke Avenue Suite I San Francisco CA 94124 USA COVERAGES CERTIFICATE NUMBER:570099366070 REVISION NUMBER: THIS IS TO CERTIFY THAT THE POLICIES OF INSURANCE LISTED BELOW HAVE BEEN ISSUED TO THE INSURED NAMED ABOVE FOR THE POLICY PERIOD INDICATED. NOTWITHSTANDING ANY REQUIREMENT, TERM OR CONDITION OF ANY CONTRACT OR OTHER DOCUMENT WITH RESPECT TO WHICH THIS CERTIFICATE MAY BE ISSUED OR MAY PERTAIN, THE INSURANCE AFFORDED BY THE POLICIES DESCRIBED HEREIN IS SUBJECT TO ALL THE TERMS, EXCLUSIONS AND CONDITIONS OF SUCH POLICIES. LIMITS SHOWN MAY HAVE BEEN REDUCED BY PAID CLAIMS.Limits shown are as requested POLICY EXP (MM/DD/YYYY) POLICY EFF (MM/DD/YYYY) SUBR WVD INSR LTR ADDL INSD POLICY NUMBER TYPE OF INSURANCE LIMITS COMMERCIAL GENERAL LIABILITY CLAIMS-MADE OCCUR POLICY LOC EACH OCCURRENCE DAMAGE TO RENTED PREMISES (Ea occurrence) MED EXP (Any one person) PERSONAL & ADV INJURY GENERAL AGGREGATE PRODUCTS - COMP/OP AGG X X X GEN'L AGGREGATE LIMIT APPLIES PER: $1,000,000 $300,000 $5,000 $1,000,000 $2,000,000 $2,000,000 A 09/29/2022 09/29/2023DT22CO3L590294TCT22 PRO- JECT OTHER: AUTOMOBILE LIABILITY ANY AUTO OWNED AUTOS ONLY SCHEDULED AUTOS HIRED AUTOS ONLY NON-OWNED AUTOS ONLY BODILY INJURY ( Per person) PROPERTY DAMAGE (Per accident) X BODILY INJURY (Per accident) $1,000,000A09/29/2022 09/29/2023 COMBINED SINGLE LIMIT (Ea accident) 810-4N125059-22-26-G EXCESS LIAB X OCCUR CLAIMS-MADE AGGREGATE EACH OCCURRENCE DED $8,000,000 $8,000,000 $10,000 09/29/2022UMBRELLA LIABB 09/29/2023CUP3L61332A2226 RETENTIONX X E.L. DISEASE-EA EMPLOYEE E.L. DISEASE-POLICY LIMIT E.L. EACH ACCIDENT $1,000,000 X OTH- ER PER STATUTEB09/29/2022 09/29/2023 $1,000,000 Y / N (Mandatory in NH) ANY PROPRIETOR / PARTNER / EXECUTIVE OFFICER/MEMBER EXCLUDED?N / AY WORKERS COMPENSATION AND EMPLOYERS' LIABILITY If yes, describe under DESCRIPTION OF OPERATIONS below $1,000,000 UB8N9035232226G Aggregate LimitZCC81N5447609/29/2022 09/29/2023 $1,000,000Per Occurrence Limit Deductible $15,000 Contractors Pollution Liability C $1,000,000 DESCRIPTION OF OPERATIONS / LOCATIONS / VEHICLES (ACORD 101, Additional Remarks Schedule, may be attached if more space is required) RE: Project Name: 2023 Concrete Reconstruction Project - Cupertino. The City, including its Council, officials, officers, employees, agents, volunteers and consultants (collectively, "Additional Insured") are included as Additional Insured in accordance with the policy provisions of the General Liability and Automobile Liability policies. General Liability policy evidenced herein is Primary and Non-Contributory to other insurance available to Additional Insured, but only in accordance with the policy's provisions. A Waiver of Subrogation is granted in favor of City of Cupertino in accordance with the policy provisions of the General Liability, Automobile Liability and Workers' Compensation policies. Should General Liability and Workers' Compensation policies be cancelled before the expiration date thereof, the policy provisions of each policy will CANCELLATIONCERTIFICATE HOLDER AUTHORIZED REPRESENTATIVECity of Cupertino 10300 Torre Avenue Cupertino CA 95014-3255 USA ACORD 25 (2016/03) ©1988-2015 ACORD CORPORATION. All rights reserved. The ACORD name and logo are registered marks of ACORD SHOULD ANY OF THE ABOVE DESCRIBED POLICIES BE CANCELLED BEFORE THE EXPIRATION DATE THEREOF, NOTICE WILL BE DELIVERED IN ACCORDANCE WITH THE POLICY PROVISIONS. govern how notice of cancellation may be delivered to certificate holders in accordance with the policy provisions of each policy. FORM TITLE:FORM NUMBER: THIS ADDITIONAL REMARKS FORM IS A SCHEDULE TO ACORD FORM, ADDITIONAL REMARKS EFFECTIVE DATE: CARRIER NAIC CODE POLICY NUMBER Aon Risk Insurance Services West, Inc. NAMED INSUREDAGENCY LOC #: 570000075061 AGENCY CUSTOMER ID: © 2008 ACORD CORPORATION. All rights reserved. See Certificate Number: See Certificate Number: The ACORD name and logo are registered marks of ACORD 570099366070 570099366070 ACORD 25 Certificate of Liability Insurance Additional Description of Operations / Locations / Vehicles: ACORD 101 (2008/01) ADDITIONAL REMARKS SCHEDULE Page _ of _ R&S Construction Management, Inc. COMM RCI L G NERAL IAB L TYEA E L I I T IS ENDORSEMENT CHANGES T E POLICY. PL ASE READ IT CAREFULLY.H H E BL ANKET ADDITIONAL INSURED (Incl des Products-Completed Operations If Required By Conturact) Thi e dorseme t m dfie i surance prov ded under he f l o ing:s n n o i s n i t o l w COMM RCI L G NERAL IAB LI Y COVERA E PARTE A E L I T G P O ISIONR V S (1)Any "bodily injury", "property dam ge" oa r "pe sonal injury arising out o the prov di g,r "f i nThe fol owing i added tol s SE TI N II – WHO IS ANC O or fa l re to prov de, any pro e sionali u i f sINSU EDR: arch te tural engineer ng o surv yingi c ,i r eAny person o o gan zat on that yo agree in ar r i i u se v ce , ncl ding:r i s i uwrit en con ract or agreem nt to in lude a ant t e c s addi ional i sured o thi Cov rage Part i at n n s e s n (a)The preparin , approv ng, or fa li g tog i i n i sured, ut onlyn b :prepa e or approv , ma s, shopre p drawi gs, opin on , reports, surv y ,n i s e sa.Wi h re pe t to l abi ity fo "bodily injury ot s c i l r " r fi l orders or change orders, or theed"prope ty dam ge that o curs, or fo "perso alr a " c r n prepa i g, approv ng, or fa l n tor n i i i gi ju y ca sed by an o fe se that is comm ttedn r " u f n i , prepa e or app ov , drawings andrr esubsequent to the signing of that contract or ag ee ent and while tha pa t o the contra t or m t r f c r spe i i a io s; andc f c t n ag ee ent s in e fe t; andr m i f c (b)Su ervso y, in pe t on, archi ect ral op i r s c i t u r b.If a d only to the ex ent that such injury o, n t ,r engineerin a t v t e .g c i i i s dama e is ca sed by a ts o om ssio s o yo og u c r i n f u r (2)Any "bodi y inju y or "prope ty dam gel r "r a "y ur subco tra tor in the perfo m nce o "y uo n c r a f o r caused by "y ur work an in luded in theo " d cwork to which the wri ten cont a t or agreemen"t r c t "produ ts-com leted o erat on hazardc p p i s "appl e . Such person or organiza ion doe noi s t s t un ess the wri ten cont a t o ag ee entlt r c r r mqual fy a an ad itional in ured with re pect toi s d s s the independent a t o omssions o such spe i i a ly requi esc s r i f c f c l r y u to prov de sucho i pe son or organizationr .cov rage fo that addi ional in ured durine r t s g the oli y pe iod.p c rThe i surance prov ded to such ad it onal insured isnid i subje t o he olo ing p ov sions:c t t f l w r i c.The ad itional insured m st com ly with thedu p a.If the Lim t o In uran e o thi Cov rage Part fo lowi g dutiei s f s c f s e l n s: shown in the De laratio s ex eed the m nim mc n c i u (1)Giv us wri ten no i e as soon a pra tica lee t t c s c bl mt requi ed by the written co tra t oi i s r n c r o an "o cur en e o an o fe se whi h m yf c r c " r f n c aag ee ent, the i surance prov ded to ther m n i re ult i a clai . To t e ex en possible suchs n m h t t ,addi ional insured wil be to suchtl no ice should in l de:t c um nim m required lim ts. Fo the purpo e oi u i r s s f de erm nin whether thi applie , thet i g s s (a)How, when an where the "o cur en edc r c " m nim m im t requi ed by the wri ten co tra t oi u l i s r t n c r or o fe se too pla e;f n k cag ee ent will be co sidered to include ther m n (b)The nam s and addre se o any inj redes s f um nim m lim ts o any Umb el a o Ex essi u i f r l r c pe sons an witne se ; andr d s sl ab l ty cov rage requi ed fo the addi ionali i i e r r t i sured by that writ en cont a t o agreem nt.n t r c r e (c)The nature and lo ation o any inj ry oc f u rThi prov sion will not increa e the lim t os i s i s f dama e ari ing out o the "o cur en eg s f c r c "i suran e de cribed in Se tion c s c n III – Lim t Ofi s or o fe se.f nIn urance.s (2)If a cla m is ma e or "sui " i brought agai sti d t s nb.The insurance prov ded to such addi ionalit the ad it onal nsuredd i i :i sured does not ap ly o:n p t CG 2 46 04 19D Pa e 1 o 2g f limited limitation © 2018 The Travelers Indemnity Company. All rights reserved. Policy Number: DT22-CO-3L590294-TCT-22 COMM RCI L G NERAL IAB LITYE A E L I (a)Im e ia ely re ord the spe i i s o them d t c c f c f (4)Te der the de ense and i dem i y o anyn f n n t f cla m or "suit an the date re eiv d; and cla m or "sui " to any prov der i " d c e i t i o othef r i suran e which woul cov r such addi ionaln c d e t(b)No i y us a soo a practi able and seet f s n s c i sured fo a lo s we cov r. Howev r, thisn r s e eto it that we re eiv wri ten noti e o thec e t c f condi ion doe not a f ct whethe thet s f e rcla m or "suit a soon a pra ti ablei " s s c c .i suran e prov ded to such addi io aln c i t n (3)Im e ia ely send us cop es o all legalm d t i f i sured i prima y to ot er insurancen s r h pape s receiv d in conne t on with the clair e c i m av ila le to such addi ional insured whi ha b t cor "sui ", coopera e wit us in thet t h cov r that person or a ae s si v stigat on o se tlem nt o the claim on e i r t e f r name i sured a de cribed i Paragraphd n s s n 4.,de e se against the "sui ", and o herwisef n t t Ot e In uran e o Se tionh r s c , f c IV – Com e cialm rcom ly wit all pol cy o ditio s.p h i c n n Ge eral ondit on .n C i s Pa e 2 o 2g f CG 2 46 04 19D organization Liability © 2018 The Travelers Indemnity Company. All rights reserved. COMM RCI L G NERAL IAB LI YEA E L I T T IS ENDORSEMENT CHANGES T E POLICY. PL ASE READ IT CAREFULLY.H H E XTEND ENDORSEMENT FO R CONTRACTORS Thi e dorseme t m dfie i surance prov ded under he f l o ing:s n n o i s n i t o l w COMM RCI L G NERAL IAB LI Y COVERAG PA TE A E L I T E R GE ERAL D SCRIP ION O CO ERAGE –N E T F V Thi endorsem nt broadens cov rage. Howev r cov rage fo anys e e e , e r i ju y, dama e o me i al ex ense descri ed in any o the provn r g r d c p s b f i ion o th s e dorseme t may bs s f i n n e ex luded orc l mted by anothe endorsem n to this Cov rage Pa t, and the e ci i r e t e r s ov rage broadening prov sions do no ap ly toeit p the ex en tha cov rage is ex l ded or lim ted by such an ent t t e c u i dorsem n . The folo ing li ti g i a ge t l w s n s eneral cov rage de cript on only Read al the provsions o thi endorse s i . l i f s em nt and the re t o y ur pol cy ca e ulles f o i r f y to de erm ne r gh s, dut es, and wha i and s not cov red.t i i t i t s i e A.Wh I An Insured – Unnam d Subsid arieo s e i s C.In i ental Medcal Mal racti ec d i p c B.Bla ket Addit onal Insured – Gov rnme taln i e n D.Bla ket Wa v r f Sub ogationn i e O r En it e – Pe mt Or Au ho iza ions Re ati g Tot i s r i s t r t l n E.Co tra tua Liab l ty – Rai roadn c l i i l sOpe atio sr n F.Da a e To Prem se Ren ed o Youm g i s t T P O ISION a.R V S An o ganizat on o he than a pa tnership, jo ntr i t r r i v nture or l m ted liab l ty company; ore i i i iA. WH IS AN INSU ED – UNNAMEDOR b.A rust;tSUBS DIARIESI The fol owing is ad ed told SE TION II – WHO ISC a indi a ed in i s nam o the docum n s thas c t t e r e t t AN INSU EDR :gov rn it stru ture.e s c Any o yo r sub idiar e , o her than a pa tnershi ,f u s i s t r p B B ANKET ADD TIONA INSURED –. L I L jo n v nture o lim ted liabil ty com any, that ii t e r i i p s GO E N ENT L EN IT ES – P RMIT OV R M A T I E S R no shown as a Nam d Insured in thete AU H R ZA I N R L TI G T O E AT O ST O I T O S E A N O P R I N i a am d In ured f:s N e s i The fol owing is ad ed told SE TION II – WHO ISCa.Yo are the so e owner o , o ma ntai anul f r i n AN INSU EDR :ownership intere t o mo e than 50% in, suchs f r Any gov r men al enti y tha ha issued a perm te n t t t s isubsidia y on the fi st day o the pol cy perio ;r r f i d or authoriza ion wit re pe t to ope ationst h s c rand pe fo med by yo or on your behal and that your r u fb.Su h subsidiary i not an in ured undecss r are required by any o dinance, law, buil ing coderdsi ila o her n urance.m r t i s or written cont act or agreeme t to incl de a anrn u s No such subsidiary i a insured fo "bodily inju ys n r r "addi ional i sured on thi Cov rage Pa t is at n s e r n or "property dama e" tha o curred, o "perso al i sured, but only wi h re pg t c r n n t s e t to liabi i y fo "bodilyc l t r i ju y", "prope ty dam ge" or "perso al andn r r a nand a v rt sing i ju y" caused by an o fe sed e i n r f n adv rti ing inj ry" ari ing ou o uch operatio s.e s u s t f s ncom i ted:mt The in uran e prov ded to such gov r men als c i e n ta.Be o e you ma ntai ed an ownership intere tf r i n s en ity doe not apply o:t s to mo e than 50% i such ub idiary; orf r n s s a.Any "bodi y inju y , "property dama e ol r "g " rb.Af e the date, i any duri g the poli y periot r f , n c d "pe sonal and adv rti ing injury" a i ing o t ore s r s u fthat yo no longer ma ntain a ownershiui n p operatio s perfo m d fo the gov r men aln r e r e n ti tere t o ore han 50% n such subsi ia y.n s f m t i d r en ity ort ;Fo purpose o Pa agraphr s f r 1.o Se tionf c II – Who b.Any "bodily inj ry or "property dam geu "a "Is An Insured, ea h such subsidiary wil becl i clu ed in the "products-co ple edn d m tdeem d to e de ignated in the Declarat on a :e b s i s s operatio s hazard".n CG 3 16 02 9D 1 © 2017 The T avelers Indemnit Company. All rightsry reserved.Pa e 1 o 3g f Includes copyrighted material of Insurance Services Of ice, Inc., with its permission.f Declarations Policy Number: DT22-CO-3L590294-TCT-22 COMM RCI L G NERAL IAB LI YE A E L I T C. IN IDEN AL ED CAL ALPRACTI EC T M I M C pharma eut cal co m t ed by o wi h thec i s m i t , r t k owledge o co sent o , the n uredn r n f i s .1.The fo lo i g repla e Pa agraphl w n c s r b.o thef de i i ion o "o cur en e in thef n t f c r c "5.The fol owing i a ded to thel s d D FIN TIONE I S D FIN TIONE I S Se tion:c Se tio :c n b.An a t o om ssio com i ted i prov dinc r i n mt n i g "In i ental m dcal se v ce " m a s:c d e i r i s e n or fa l ng to prov de "incidental me icai i i d l a.Medcal surgi al dental laborato y, x rayi , c , , r -se v ce ", fi st a d o "Good Sam rtanr i s r i r a i or nur ing se vce or treatm n , advce os r i e t i rse v ce " to a person, unle s yo are ir i s s u n i struction o the related fur i hi g on , r n s n fthe busine s or o cupat on o prov dins c i f i g fo d or bev rages; oro epro e sional hea th a e se vce .f s l c r r i s b.The furni hing o di pensing o dru s os r s f g r2.The fo lowi g rep a es the la t paragraph ol n l c s f m dcal dental o surgi al supplie oe i , , r c s rPa ag aphr r 2. .(1)a of SECTI N II – WHO ISO appl a ce .i n sAN INSU EDR : 6.The fol o ing i added to Parag aphl w s r 4.b.,Unle s yo a e in the business or o cupatios u r c n Ex ess In urancec s , of SE TION IV –Co prov di g pro e sional healt ca e se v ce ,f i n f s h r r i s Pa ag aphsr r (1) a)(,(b),(c)and (d)abov doe CO MERCIAL GENE AL LIABI ITMRL Y COND T ONI I Snot apply to :"bodily injury" arising out of prov din o ai ing o rov de:i g r f l t p i Thi i surance i ex e s ov r any v li ans n s c s e a d d (a)"In i ental me ica se v ce " by any oc d d l r i s f col e ti le othe in urance whether prim ry,l c b r s ,a y ur "em loyee " who is a nu se, nurseo p s r ex e s, conti gent o on any other ba is, thatc s n r s a sistant, em rgen y me i al techni iase c d c c n i av ilab e to any o your "em loy es" fos a l f p e r or arame ic; orp d "bo ily injury that ari e ou o prov ding od " s s t f i r fa l n to prov de "i cidental medi al servce "i i g i n c i s(b)F rst ai or "Good Sama itan se v ce " byi d r r i s a y o y u "em loyee " o "to any perso to the ex ent notn f o r p s r n t subje t tocv lunteero Pa ag aphr r 2.a. 1)(o Se t onf c i II – Who Is Anworkers", other than an employed or v lunteer do tor. Any such "em loyee "o c p s In ured.s or "v lu teer wo kers" prov ding o fa l ngo n r i r i i D B ANKET WAIVER O SUB O ATION. L F R Gto prov de fi st aid or "Good Sama i ani r r t The fo lowing is a ded to Paragraphl d 8.,Tra sfen rse v ce " during thei work hou s fo your i s r r r O Righ s O Reco ery Agai st O hers To Usf t f v n t ,wil be deem d to be a t ng wi hin thel e c i t of SE TION IV – CO MERCIAL GENERALCMsco e o thei em loym nt by yo op f r p e u r pe fo m n dutie rela ed to the co du tr r i g s t n c L ABI I Y CO D T ONI L T N I I S : o yo r busine s.f u s If the insured has a ree in a cont act og d r r 3.The fo lo i g repla e the la t se tence ol w n c s s n f ag ee ent to waiv that i sured' righ or m e n s t f Pa ag aphr r 5.of SE TION III – LIMITS OCF re ov ry against any person o o gan zat on, wec e r r i i INSU AN ER C :waiv our right o e ov ry again t uch pe son oe f r c e s s r r organi ation, but only fo pay ents we ma ezr m kFo the purpo e o dete m nin thers s f r i g be ause o :c fappl cable Ea h Occurrence Lim t, al relatedi c i l a t or om ssions com i ted i prov di g oc s i mt n i n r a."Bo ily i ju y" o "property dam ge" thatd n r r a fa l n to prov de "inci ental me icai i g i d d l o curs; oc rse v ce ", fi st a d o "Good Sam rtanr i s r i r a i b."Pe so al and adv rti ing inj ry" ca sed byr n e s u use v ce " to any one perso wil be deeme tor i s n l d an o fe se hat i com it edf n t s m t ;be one "o currence".c 4.The fo lowi g ex lu ion i added to subsequent to the ex cution o thel n c s s e f cont a t or c r Pa ag aphr r 2.,Exclus oni s , of SE TION I –C ag ee ent.r m CO ERAGES – CO ERAGE A – BODI YVVL E. CON RACTUAL IABILIT – RAIL OADTL Y R SINJU Y AND P OP RT DAMAGERR E Y L ABI I YI L T :1.The fol o ing repla e Pa agraphl w c s r c.o thef de i i ion o "insured cont act" i thef n t f r nSa e O Ph rmaceu icalsl f a t D FIN TIONE I S Se tion:c"Bo ily inju y or "property dama e" ari ingd r "g s ou o the v ola ion o a penal stat te ot f i t f u r c.Any ea em nt or l cense agreem nt;s e i e ordi ance rela i g to the sale ont n f Pa e 2 o 3g f © 2017 The T avelers Indemnit Company. All rightsry reserved.CG 3 16 02 9D 1 Includes copyrighted material of nsurance Services Of iceIf , Inc., with its permission. COMM RCI L G NERAL IAB LITYE A E L I 2.Pa ag aphr r f. 1)(o the de init o o "i suredf f i n f n a.Any prem se whi e rented to yo oi s l u r cont a t i ther c " n D FIN TIONE I S Se tion is tem ora i y o cupied by you wi h pe m ssionc p r l c t r i de eted.o he owne ; orlf t r F DAMAGE TO P EMISE EN ED TO YOU b. R S R T .The co tent o any premi e whi e suchn s f s s l prem se i rented to yo , i y u rent suchi s s u f oThe fol owing repla e the de i ition o "prem sel c s f n f i s prem se fo a period o sev n or fewei s r f e rdama e in heg " t DEF NIT ONSI I Se tionc :conse utiv day .c e s"Pre i e dama e m a s "property dama e" to:m s s g " e n g CG 3 16 02 9D 1 © 2017 The T avelers Indemnit Company. All righ sr y t reserved.Pa e 3 o 3g f Includes copyrighted material of nsurance Services Of iceI f , Inc., with its permission. CA T3 53 02 15 Page 1 of 4© 2015 The Travelers Indemnity Company. All rights reserved. Includes copyrighted material of Insurance Services Office, Inc. with its permission. Insured: R&S Construction Management, Inc. Effective: 9/29/2022-23 Policy Number: 810-4N125059-22-26-G COMMERCIAL AUTO THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. BUSINESS AUTO EXTENSION ENDORSEMENT This endorsement modifies insurance provided under the following: BUSINESS AUTO COVERAGE FORM GENERAL DESCRIPTION OF COVERAGE - This endorsement broadens coverage. However, coverage for any injury, damage or medical expenses described in any of the provisions of this endorsement may be excluded or limited by another endorsement to the Coverage Part, and these coverage broadening provisions do not apply to the extent that coverage is excluded or limited by such an endorsement. The following listing is a general cover- age description only. Limitations and exclusions may apply to these coverages. Read all the provisions of this en- dorsement and the rest of your policy carefully to determine rights, duties, and what is and is not covered. A.BROAD FORM NAMED INSURED H. HIRED AUTO PHYSICAL DAMAGE - LOSS OF B.BLANKET ADDITIONAL INSURED USE - INCREASED LIMITI.PHYSICAL DAMAGE - TRANSPORTATION C.EMPLOYEE HIRED AUTO D.EMPLOYEES AS INSURED E.SUPPLEMENTARY PAYMENTS - INCREASED LIMITS F.HIRED AUTO - LIMITED WORLDWIDE COV- ERAGE - INDEMNITY BASIS G.WAIVER OF DEDUCTIBLE - GLASS PROVISIONS A.BROAD FORM NAMED INSURED The following is added to Paragraph A.1., Who Is An Insured, of SECTION II - COVERED AUTOS LIABILITY COVERAGE: Any organization you newly acquire or form dur- ing the policy period over which you maintain 50% or more ownership interest and that is not separately insured for Business Auto Coverage. Coverage under this provision is afforded only un- til the 180th day after you acquire or form the or- ganization or the end of the policy period, which- ever is earlier. B.BLANKET ADDITIONAL INSURED The following is added to Paragraph c. in A.1., Who Is An Insured, of SECTION II - COVERED AUTOS LIABILITY COVERAGE: Any person or organization who is required under a written contract or agreement between you and that person or organization, that is signed and executed by you before the "bodily injury" or "property damage" occurs and that is in effect during the policy period, to be named as an addi- tional insured is an "insured" for Covered Autos Liability Coverage, but only for damages to which EXPENSES - INCREASED LIMIT J.PERSONAL PROPERTY K. AIRBAGS L.NOTICE AND KNOWLEDGE OF ACCIDENT OR LOSS M.BLANKET WAIVER OF SUBROGATION N.UNINTENTIONAL ERRORS OR OMISSIONS this insurance applies and only to the extent that person or organization qualifies as an "insured" under the Who Is An Insured provision contained in Section II. C.EMPLOYEE HIRED AUTO 1.The following is added to Paragraph A.1., Who Is An Insured, of SECTION II - COV- ERED AUTOS LIABILITY COVERAGE: An "employee" of yours is an "insured" while operating an "auto" hired or rented under a contract or agreement in an "employee's" name, with your permission, while performing duties related to the conduct of your busi- ness. 2.The following replaces Paragraph b. in B.5., Other Insurance, of SECTION IV - BUSI- NESS AUTO CONDITIONS: b.For Hired Auto Physical Damage Cover- age, the following are deemed to be cov- ered "autos" you own: (1)Any covered "auto" you lease, hire, rent or borrow; and (2)Any covered "auto" hired or rented by your "employee" under a contract in an "employee's" name, with your Page 2 of 4 CA T3 53 02 15© 2015 The Travelers Indemnity Company. All rights reserved. Includes copyrighted material of Insurance Services Office, Inc. with its permission. COMMERCIAL AUTO perm1ss1on, while performing duties related to the conduct of your busi- ness. However, any "auto" that is leased, hired, rented or borrowed with a driver is not a covered "auto". D.EMPLOYEES AS INSURED The following is added to Paragraph A.1., Who Is An Insured, of SECTION II - COVERED AUTOS LIABILITY COVERAGE: Any "employee" of yours is an "insured" while us- ing a covered "auto" you don't own, hire or borrow in your business or your personal affairs. E.SUPPLEMENTARY PAYMENTS - INCREASED LIMITS 1.The following replaces Paragraph A.2.a.(2), of SECTION II - COVERED AUTOS LIABIL- ITY COVERAGE: (2)Up to $3,000 for cost of bail bonds (in- cluding bonds for related traffic law viola- tions) required because of an "accident" we cover. We do not have to furnish these bonds. 2.The following replaces Paragraph A.2.a.(4), of SECTION II - COVERED AUTOS LIABIL- ITY COVERAGE: (4)All reasonable expenses incurred by the "insured" at our request, including actual loss of earnings up to $500 a day be- cause of time off from work. F.HIRED AUTO - LIMITED WORLDWI DE COV- ERAGE - INDEMNITY BASIS The following replaces Subparagraph (5) in Para- graph B.7., Policy Period, Coverage Territory, of SECTION IV - BUSINESS AUTO CONDI- TIONS: (5)Anywhere in the world, except any country or jurisdiction while any trade sanction, em- bargo, or similar regulation imposed by the United States of America applies to and pro- hibits the transaction of business with or within such country or jurisdiction, for Cov- ered Autos Liability Coverage for any covered "auto" that you lease, hire, rent or borrow without a driver for a period of 30 days or less and that is not an "auto" you lease, hire, rent or borrow from any of your "employees", partners (if you are a partnership), members (if you are a limited liability company) or members of their households. (a)With respect to any claim made or "suit" brought outside the United States of America, the territories and possessions of the United States of America, Puerto Rico and Canada: (i)You must arrange to defend the "in- sured" against, and investigate or set- tle any such claim or "suit" and keep us advised of all proceedings and ac- tions. (ii)Neither you nor any other involved "insured" will make any settlement without our consent. (iii)We may, at our discretion, participate in defending the "insured" against, or in the settlement of, any claim or "suit". (iv)We will reimburse the "insured" for sums that the "insured" legally must pay as damages because of "bodily injury" or "property damage" to which this insurance applies, that the "in- sured" pays with our consent, but only up to the limit described in Para- graph C., Limits Of Insurance, of SECTION II - COVERED AUTOS LIABILITY COVERAGE. (v)We will reimburse the "insured" for the reasonable expenses incurred with our consent for your investiga- tion of such claims and your defense of the "insured" against any such "suit", but only up to and included within the limit described in Para- graph C., Limits Of Insurance, of SECTION II - COVERED AUTOS LIABILITY COVERAGE, and not in addition to such limit. Our duty to make such payments ends when we have used up the applicable limit of insurance in payments for damages, settlements or defense expenses. (b)This insurance is excess over any valid and collectible other insurance available to the "insured" whether primary, excess, contingent or on any other basis. (c)This insurance is not a substitute for re- quired or compulsory insurance in any country outside the United States, its ter- ritories and possessions, Puerto Rico and Canada. CA T3 53 02 15 Page 3 of 4© 2015 The Travelers Indemnity Company. All rights reserved. Includes copyrighted material of Insurance Services Office, Inc. with its permission. COMMERCIAL AUTO You agree to maintain all required or compulsory insurance in any such coun- try up to the minimum limits required by local law. Your failure to comply with compulsory insurance requirements will not invalidate the coverage afforded by this policy, but we will only be liable to the same extent we would have been liable had you complied with the compulsory in- surance requirements. (d)It is understood that we are not an admit- ted or authorized insurer outside the United States of America, its territories and possessions, Puerto Rico and Can- ada. We assume no responsibility for the furnishing of certificates of insurance, or for compliance in any way with the laws of other countries relating to insurance. G.WAIVER OF DEDUCTIBLE - GLASS The following is added to Paragraph D., Deducti- ble, of SECTION Ill - PHYSICAL DAMAGE COVERAGE: No deductible for a covered "auto" will apply to glass damage if the glass is repaired rather than replaced. H.HIRED AUTO PHYSICAL DAMAGE - LOSS OF USE - INCREASED LIMIT The following replaces the last sentence of Para- graph A.4.b., Loss Of Use Expenses, of SEC- TION Ill - PHYSICAL DAMAGE COVERAGE: However, the most we will pay for any expenses for loss of use is $65 per day, to a maximum of $750 for any one "accident". I.PHYSICAL DAMAGE - TRANSPORTATI ON EXPENSES - INCREASED LIMIT The following replaces the first sentence in Para- graph A.4.a., Transportation Expenses, of SECTION Ill - PHYSICAL DAMAGE COVER- AGE: We will pay up to $50 per day to a maximum of $1,500 for temporary transportation expense in- curred by you because of the total theft of a cov- ered "auto" of the private passenger type. J.PERSONAL PROPERTY The following is added to Paragraph A.4., Cover- age Extensions, of SECTION Ill - PHYSICAL DAMAGE COVERAGE: Personal Property We will pay up to $400 for "loss" to wearing ap- parel and other personal property which is: (1)Owned by an "insured"; and (2)In or on your covered "auto". This coverage applies only in the event of a total theft of your covered "auto". No deductibles apply to this Personal Property coverage. K.AIRBAGS The following is added to Paragraph B.3., Exclu- sions, of SECTION Ill - PHYSICAL DAMAGE COVERAGE: Exclusion 3.a. does not apply to "loss" to one or more airbags in a covered "auto" you own that in- flate due to a cause other than a cause of "loss" set forth in Paragraphs A.1.b. and A.1.c., but only: a.If that "auto" is a covered "auto" for Compre- hensive Coverage under this policy; b. The airbags are not covered under any war- ranty; and c. The airbags were not intentionally inflated. We will pay up to a maximum of $1,000 for any one "loss". L.NOTICE AND KNOWLEDGE OF ACCIDENT OR LOSS The following is added to Paragraph A.2.a., of SECTION IV - BUSINESS AUTO CONDITIONS: Your duty to give us or our authorized representa- tive prompt notice of the "accident" or "loss" ap- plies only when the "accident" or "loss" is known to: (a)You (if you are an individual); (b)A partner (if you are a partnership); (c)A member (if you are a limited liability com- pany); (d)An executive officer, director or insurance manager (if you are a corporation or other or- ganization); or (e)Any "employee" authorized by you to give no- tice of the "accident" or "loss". M.BLANKET WAIVER OF SUBROGATION The following replaces Paragraph A.5., Transfer Of Rights Of Recovery Against Others To Us, of SECTION IV - BUSINESS AUTO CONDI- TIONS: 5.Transfer Of Rights Of Recovery Against Others To Us We waive any right of recovery we may have against any person or organization to the ex- tent required of you by a written contract signed and executed prior to any "accident" or "loss", provided that the "accident" or "loss" arises out of operations contemplated by COMMERCIAL AUTO Page 4 of 4 CA T3 53 02 15© 2015 The Travelers Indemnity Company. All rights reserved. Includes copyrighted material of Insurance Services Office, Inc. with its permission. such contract. The waiver applies only to the person or organization designated in such contract. N.UNINTENTIONAL ERRORS OR OMISSIONS The following is added to Paragraph B.2., Con- cealment, Misrepresentation, Or Fraud, of SECTION IV - BUSINESS AUTO CONDITIONS: The unintentional om1ss1on of, or unintentional error in, any information given by you shall not prejudice your rights under this insurance. How- ever this provision does not affect our right to col- lect additional premium or exercise our right of cancellation or non-renewal. WORKERS COMPENSATION (BLANKET WAIVER) WAIVER OF OUR RIGHT TO RECOVER FROM OTHERS POLICY NUMBER: AND EMPLOYERS LIABILITY POLICY ENDORSEMENT – CALIFORNIA ENDORSEMENT WC 99 03 76 ( A) - UB-8N903523-22-26-G HARTFORD CT 06183 ONE TOWER SQUARE 001 Schedule Job DescriptionPerson or Organization We have the right to recover our payments from anyone liable for an injury covered by this policy. We will not enforce our right against the person or organization named in the Schedule. The additional premium for this endorsement shall be % of the California workers' compensation pre- mium. 2.00 ANY PERSON OR ORGANIZATION FOR WHICH THE INSURED HAS AGREED BY WRITTEN CONTRACT EXECUTED PRIOR TO LOSS TO FURNISH THIS WAIVER. Countersigned byInsurance Company PremiumInsured Endorsement No.Policy No.Endorsement Effective This endorsement changes the policy to which it is attached and is effective on the date issued unless otherwise stated. (The information below is required only when this endorsement is issued subsequent to preparation of the policy.) ST ASSIGN: DATE OF ISSUE: Page of09-28-22 1 1 2023 Concrete Reconstruction Project 2021 Form NOTICE INVITING BIDS 2023-104 Page 1 Notice Inviting Bids 1.Bid Submission. City of Cupertino (“City”) will accept electronically submitted bids for its 2023 Concrete Reconstruction Project (“Project”), by or before March 21, 2023 at 2:00 p.m., via electronic submission to the City’s “Business Opportunities” online portal in the manner set forth in Section 1 of the Instructions to Bidders, at which time the bids will be opened by the City. 2.Project Information. 2.1 2.2 Location and Description. The Project is located in City of Cupertino. Work will occur at various locations throughout the City. Work is generally described as follows: Remove/Replace existing concrete curbs, gutters and sidewalks at various locations throughout the City. Work also includes installation of ADA ramps, upgrading existing ADA ramps to current standard, removal/replacement of driveway approaches and removal/replacement of asphalt adjacent to curbs. Time for Final Completion. All curb and gutter repairs and ADA ramps on streets to be paved in 2023 must be complete by June 20, 2023. All other work must be complete within 145 calendar days from the start date set forth in the Notice to Proceed. City anticipates that the Work will begin on or about May 8, 2023, but the anticipated start date is provided solely for convenience and is neither certain nor binding. 3.License and Registration Requirements. 3.1 3.2 License. This Project requires a valid California contractor’s license for the following classification(s): Class A or Class C-8. DIR Registration. City may not accept a Bid Proposal from or enter into the Contract with a bidder, without proof that the bidder is registered with the California Department of Industrial Relations (“DIR”) to perform public work pursuant to Labor Code § 1725.5, subject to limited legal exceptions. 4.Contract Documents. The plans, specifications, bid forms and contract documents for the Project, and any addenda thereto (“Contract Documents”) may be downloaded from City’s website located at: https://apps.cupertino.org/bidmanagement/index.aspx. A printed copy of the Contract Documents are not available. 5.Bid Security. Each bidder must submit bid security equal to ten percent of the maximum bid amount, in the form of a cashier’s or certified check made payable to City, or a bid bond executed by a surety licensed to do business in the State of California on the Bid Bond form included with the Contract Documents, in the manner set forth in Section 4 of the Instructions to Bidders. The bid security must guarantee that within ten days after City issues the Notice of Potential Award, the successful bidder will execute the Contract and submit the payment and performance bonds, insurance certificates and endorsements, and any other submittals required by the Contract Documents and as specified in the Notice of Potential Award. 6.Prevailing Wage Requirements. 6.1 General. Pursuant to California Labor Code § 1720 et seq., this Project is subject to the prevailing wage requirements applicable to the locality in which the Work is to be performed for each craft, classification or type of worker needed to perform 2023 Concrete Reconstruction Project 2021 Form NOTICE INVITING BIDS 2023-104 Page 2 the Work, including employer payments for health and welfare, pension, vacation, apprenticeship and similar purposes. 6.2 Rates. These prevailing rates are on file with the City and are available online at http://www.dir.ca.gov/DLSR. Each Contractor and Subcontractor must pay no less than the specified rates to all workers employed to work on the Project. The schedule of per diem wages is based upon a working day of eight hours. The rate for holiday and overtime work must be at least time and one-half. 6.3 Compliance. The Contract will be subject to compliance monitoring and enforcement by the DIR, under Labor Code § 1771.4. 7.Performance and Payment Bonds. The successful bidder will be required to provide performance and payment bonds, each for 100% of the Contract Price, as further specified in the Contract Documents. 8.Substitution of Securities. Substitution of appropriate securities in lieu of retention amounts from progress payments is permitted under Public Contract Code § 22300. 9.Subcontractor List. Each Subcontractor must be registered with the DIR to perform work on public projects. Each bidder must submit a completed Subcontractor List form with its Bid Proposal, including the name, location of the place of business, California contractor license number, DIR registration number, and percentage of the Work to be performed (based on the base bid price) for each Subcontractor that will perform Work or service or fabricate or install Work for the prime contractor in excess of one-half of 1% of the bid price, using the Subcontractor List form included with the Contract Documents. 10.Instructions to Bidders. All bidders should carefully review the Instructions to Bidders for more detailed information before submitting a Bid Proposal. The definitions provided in Article 1 of the General Conditions apply to all of the Contract Documents, as defined therein, including this Notice Inviting Bids. By: ___________________________________ Date: ________________ Kirsten Squarcia, City Clerk Publication Date: March 3, 2023 END OF NOTICE INVITING BIDS 2/23/23 2023 Concrete Reconstruction Project 2021 Form INSTRUCTIONS TO BIDDERS 2023-104 Page 4 Instructions to Bidders Each Bid Proposal submitted to the City of Cupertino (“City”) for its 2023 Concrete Reconstruction Project (“Project”) must be submitted in accordance with the following instructions and requirements: 1. Bid Submission. 1.1 General. Each Bid Proposal must be signed and submitted to City, using the form provided in the Contract Documents, by or before the date and time set forth in Section 1 of the Notice Inviting Bids, or as amended by subsequent addendum, via electronic submission only as specified below in Section 1.2. Faxed, hand- delivered, mailed or emailed Bid Proposals will not be accepted, unless otherwise specified. Late submissions will not be considered. City reserves the right to postpone the date or time for receiving or opening bids. Each bidder is solely responsible for all of its costs to prepare and submit its bid and by submitting a bid waives any right to recover those costs from City. The bid price(s) must include all costs to perform the Work as specified, including all labor, material, supplies, and equipment and all other direct or indirect costs such as applicable taxes, insurance and overhead. 1.2 Electronic Submission. The Bid Proposal and all required forms and attachments must be submitted in PDF format on the City’s “Business Opportunities” portal at https://apps.cupertino.org/bidmanagement/index.aspx. To submit a bid, (1) select the folder icon in the “Actions” column for the Project; (2) select the “Electronic Submission” tab; (3) when the log-in screen appears, enter the log-in credentials used to access the Contract Documents and/or create an account, as appropriate; (4) after logging in, carefully follow all instructions for electronic submission of the Bid Proposal and all required forms and attachments. Each bidder should familiarize itself with the City’s “Business Opportunities” portal before the bid deadline. Electronic submission may take more time than anticipated. Each bidder should plan accordingly and afford itself ample time to upload its bid. Bids that are in the process of uploading but are not completely uploaded by the bid deadline will be automatically rejected by the portal. The portal will not allow submission after the bid deadline. On the next Working Day following the bid opening, the City will post the bid results to https://apps.cupertino.org/bidmanagement/index.aspx. 1.3 DIR Registration. Subject to limited legal exceptions for joint venture bids and federally-funded projects, City may not accept a Bid Proposal from a bidder without proof that the bidder is registered with the DIR to perform public work under Labor Code § 1725.5. If City is unable to confirm that the bidder is currently registered with the DIR, City may disqualify the bidder without opening its bid. (Labor Code §§ 1725.5 and 1771.1(a).) 2. Bid Proposal Form and Enclosures. Each Bid Proposal must be completed legibly using the Bid Proposal form included with the Contract Documents. The Bid Proposal form must be fully completed without interlineations, alterations, or erasures. Any necessary corrections must be clear and legible, and must be initialed by the bidder’s authorized representative. A Bid Proposal submitted with exceptions or terms such as “negotiable,” “will negotiate,” or similar, will be considered nonresponsive. Each Bid Proposal must be accompanied by a completed Subcontractor List and Non-Collusion Declaration using the forms included with the Contract Documents, a PDF copy of the bid security, and any additional forms required by the Notice Inviting Bids or Instructions to Bidders. In addition to 2023 Concrete Reconstruction Project 2021 Form INSTRUCTIONS TO BIDDERS 2023-104 Page 5 submitting a PDF copy of the bid security, each bidder must also send the original form of bid security to the City, as set forth in Section 4, below. 3. Authorization and Execution. Each Bid Proposal must be signed by the bidder’s authorized representative. A Bid Proposal submitted by a partnership must be signed in the partnership name by a general partner with authority to bind the partnership. A Bid Proposal submitted by a corporation must be signed with the legal name of the corporation, followed by the signature and title of two officers of the corporation with full authority to bind the corporation to the terms of the Bid Proposal, under California Corporation Code § 313. 4. Bid Security. Each bid must be guaranteed by bid security of ten percent of the maximum bid amount, in the form of a cashier’s or certified check made payable to the City, or bid bond using the form included in the Contract Documents and executed by a surety licensed to do business in the State of California. 4.1 Form of Security and Submission. In addition to submitting a PDF copy of the bid security, the wet-inked original bid bond, cashier’s or certified check, must be sent to the City via U.S. Mail or a reliable overnight delivery service in a sealed envelope addressed to City of Cupertino, Office of the City Clerk, 10300 Torre Avenue, Cupertino, CA 95014 and clearly labeled with the bidder’s legal name and address, the Project title, and date and time of the bid deadline. The envelope containing the original form of bid security must be postmarked or otherwise dated to show that it was submitted to the United States Postal Service or overnight delivery service by or before the date of the bid deadline. 4.2 Bid Guarantee. The bid security must guarantee that, within ten days after issuance of the Notice of Potential Award, the bidder will: execute and submit the enclosed Contract for the bid price; submit payment and performance bonds for 100% of the maximum Contract Price; and submit the insurance certificates and endorsements and any other submittals, if any, required by the Contract Documents or the Notice of Potential Award. A Bid Proposal may not be withdrawn for a period of 60 days after the bid opening without forfeiture of the bid security, except as authorized for material error under Public Contract Code § 5100 et seq. 5. Requests for Information. Questions or requests for clarifications regarding the Project, the bid procedures, or any of the Contract Documents must be submitted in writing to Jo Anne Johnson, Project Manager, at joannej@cupertino.org. Oral responses are not authorized and are not binding on the City. Bidders should submit any such written inquiries at least five Working Days before the scheduled bid opening. Questions received any later might not be addressed before the bid deadline. An interpretation or clarification by City in response to a written inquiry will be issued in an addendum. 6. Pre-Bid Investigation. 6.1 General. Each bidder is solely responsible at its sole expense for diligent and thorough review of the Contract Documents, examination of the Project site, and reasonable and prudent inquiry concerning known and potential site and area conditions prior to submitting a Bid Proposal. Each bidder is responsible for knowledge of conditions and requirements which reasonable review and investigation would have disclosed. However, except for any areas that are open to the public at large, bidders may not enter property owned or leased by the City or the Project site without prior written authorization from City. 6.2 Document Review. Each bidder is responsible for review of the Contract Documents and any informational documents provided “For Reference Only,” e.g., 2023 Concrete Reconstruction Project 2021 Form INSTRUCTIONS TO BIDDERS 2023-104 Page 6 as-builts, technical reports, test data, and the like. A bidder is responsible for notifying City of any errors, omissions, inconsistencies, or conflicts it discovers in the Contract Documents, acting solely in its capacity as a contractor and subject to the limitations of Public Contract Code § 1104. Notification of any such errors, omissions, inconsistencies, or conflicts must be submitted in writing to the City no later than five Working Days before the scheduled bid opening. (See Section 5, above.) City expressly disclaims responsibility for assumptions a bidder might draw from the presence or absence of information provided by City. 6.3 Project Site. Questions regarding the availability of soil test data, water table elevations, and the like should be submitted to the City in writing, as specified in Section 5, above. Any subsurface exploration at the Project site must be done at the bidder’s expense, but only with prior written authorization from City. All soil data and analyses available for inspection or provided in the Contract Documents apply only to the test hole locations. Any water table elevation indicated by a soil test report existed on the date the test hole was drilled. The bidder is responsible for determining and allowing for any differing soil or water table conditions during construction. Because groundwater levels may fluctuate, difference(s) in elevation between ground water shown in soil boring logs and ground water actually encountered during Project construction will not be considered changed Project site conditions. Actual locations and depths must be determined by bidder’s field investigation. The bidder may request access to underlying or background information on the Project site in City’s possession that is necessary for the bidder to form its own conclusions, including, if available, record drawings or other documents indicating the location of subsurface lines, utilities, or other structures. 6.4 Utility Company Standards. The Project must be completed in a manner that satisfies the standards and requirements of any affected utility companies or agencies (collectively, “utility owners”). The successful bidder may be required by the third party utility owners to provide detailed plans prepared by a California registered civil engineer showing the necessary temporary support of the utilities during coordinated construction work. Bidders are directed to contact the affected third party utility owners about their requirements before submitting a Bid Proposal. 7. Bidders Interested in More Than One Bid. No person, firm, or corporation may submit or be a party to more than one Bid Proposal unless alternate bids are specifically called for. However, a person, firm, or corporation that has submitted a subcontract proposal or quote to a bidder may submit subcontract proposals or quotes to other bidders. 8. Addenda. Any addenda issued prior to the bid opening are part of the Contract Documents. Subject to the limitations of Public Contract Code § 4104.5, City reserves the right to issue addenda prior to bid time. Each bidder is solely responsible for ensuring it has received and reviewed all addenda prior to submitting its bid. Bidders should check City’s website periodically for any addenda or updates on the Project at: https://apps.cupertino.org/bidmanagement/index.aspx . 9. Brand Designations and “Or Equal” Substitutions. Any specification designating a material, product, thing, or service by specific brand or trade name, followed by the words “or equal,” is intended only to indicate quality and type of item desired, and bidders may request use of any equal material, product, thing, or service. All data substantiating the proposed substitute as an equal item must be submitted with the written request for substitution. A request for substitution must be submitted within 35 days after Notice of Potential Award unless otherwise provided in the Contract Documents. This provision does not apply to materials, products, things, or services that may lawfully be designated by a specific brand or trade name under Public Contract Code § 3400(c). 2023 Concrete Reconstruction Project 2021 Form INSTRUCTIONS TO BIDDERS 2023-104 Page 7 10. Bid Protest. Any bid protest against another bidder must be submitted in writing and received by City at Cupertino City Clerk located at 10300 Torre Ave, Cupertino CA 95014 or sent via email at joannej@cupertino.org before 5:00 p.m. no later than two Working Days following the date upon which the City posts the bid results (“Bid Protest Deadline”) and must comply with the following requirements: 10.1 General. Only a bidder who has actually submitted a Bid Proposal is eligible to submit a bid protest against another bidder. Subcontractors are not eligible to submit bid protests. A bidder may not rely on the bid protest submitted by another bidder, but must timely pursue its own protest. If required by City, the protesting bidder must submit a non-refundable fee in the amount specified by City, based upon City’s reasonable costs to administer the bid protest. Any such fee must be submitted to City no later than the Bid Protest Deadline, unless otherwise specified. For purposes of this Section 10, a “Working Day” means a day that City is open for normal business, and excludes weekends and holidays observed by City. Pursuant to Public Contract Code § 4104, inadvertent omission of a Subcontractor’s DIR registration number on the Subcontractor List form is not grounds for a bid protest, provided it is corrected within 24 hours of the bid opening or as otherwise provided under Labor Code § 1771.1(b). 10.2 Protest Contents. The bid protest must contain a complete statement of the basis for the protest and must include all supporting documentation. Material submitted after the Bid Protest Deadline will not be considered. The protest must refer to the specific portion or portions of the Contract Documents upon which the protest is based. The protest must include the name, address, email address, and telephone number of the protesting bidder and any person submitting the protest on behalf of or as an authorized representative of the protesting bidder. 10.3 Copy to Protested Bidder. Upon submission of its bid protest to City, the protesting bidder must also concurrently transmit the protest and all supporting documents to the protested bidder, and to any other bidder who has a reasonable prospect of receiving an award depending upon the outcome of the protest, by email or hand delivery to ensure delivery before the Bid Protest Deadline. 10.4 Response to Protest. The protested bidder may submit a written response to the protest, provided the response is received by City before 5:00 p.m., within two Working Days after the Bid Protest Deadline or after actual receipt of the bid protest, whichever is sooner (the “Response Deadline”). The response must attach all supporting documentation. Material submitted after the Response Deadline will not be considered. The response must include the name, address, email address, and telephone number of the person responding on behalf of or representing the protested bidder if different from the protested bidder. 10.5 Copy to Protesting Bidder. Upon submission of its response to the bid protest to the City, the protested bidder must also concurrently transmit by email or hand delivery, by or before the Response Deadline, a copy of its response and all supporting documents to the protesting bidder and to any other bidder who has a reasonable prospect of receiving an award depending upon the outcome of the protest. 10.6 Exclusive Remedy. The procedure and time limits set forth in this Section are mandatory and are the bidder’s sole and exclusive remedy in the event of a bid protest. A bidder’s failure to comply with these procedures will constitute a waiver 2023 Concrete Reconstruction Project 2021 Form INSTRUCTIONS TO BIDDERS 2023-104 Page 8 of any right to further pursue a bid protest, including filing a Government Code Claim or initiation of legal proceedings. 10.7 Right to Award. City reserves the right, acting in its sole discretion, to reject any bid protest that it determines lacks merit, to award the Contract to the bidder it has determined to be the responsible bidder submitting the lowest responsive bid, and to issue a Notice to Proceed with the Work notwithstanding any pending or continuing challenge to its determination. 11. Reservation of Rights. City reserves the unfettered right, acting in its sole discretion, to waive or to decline to waive any immaterial bid irregularities; to accept or reject any or all bids; to cancel or reschedule the bid; to postpone or abandon the Project entirely; or to perform all or part of the Work with its own forces. The Contract will be awarded, if at all, within 60 days after opening of bids or as otherwise specified in the Special Conditions, to the responsible bidder that submitted the lowest responsive bid. Any planned start date for the Project represents the City’s expectations at the time the Notice Inviting Bids was first issued. City is not bound to issue a Notice to Proceed by or before such planned start date, and it reserves the right to issue the Notice to Proceed when the City determines, in its sole discretion, the appropriate time for commencing the Work. The City expressly disclaims responsibility for any assumptions a bidder might draw from the presence or absence of information provided by the City in any form. Each bidder is solely responsible for its costs to prepare and submit a bid, including site investigation costs. 12. Bonds. Within ten calendar days following City’s issuance of the Notice of Potential Award to the apparent low bidder, the bidder must submit payment and performance bonds to City as specified in the Contract Documents using the bond forms included in the Contract Documents. All required bonds must be calculated on the maximum total Contract Price as awarded, including additive alternates, if applicable. 13. License(s). The successful bidder and its Subcontractor(s) must possess the California contractor’s license(s) in the classification(s) required by law to perform the Work. The successful bidder must also obtain a City business license within 5 days following City’s issuance of the Notice of Potential Award. Subcontractors must also obtain a City business license before performing any Work. 14. Ineligible Subcontractor. Any Subcontractor who is ineligible to perform work on a public works project under Labor Code §§ 1777.1 or 1777.7 is prohibited from performing work on the Project. 15. Safety Orders. If the Project includes construction of a pipeline, sewer, sewage disposal system, boring and jacking pits, or similar trenches or open excavations, which are five feet or deeper, each bid must include a bid item for adequate sheeting, shoring, and bracing, or equivalent method, for the protection of life or limb, which comply with safety orders as required by Labor Code § 6707. 16. Subcontractor Work Limits. The prime contractor must perform at least 55% of the Work on the Project, calculated as a percentage of the base bid price, with its own forces, except for any Work identified as “Specialty Work” in the Contract Documents. The total bid amount for any such Specialty Work, as shown on the Bid Schedule, may be deducted from the base bid price before computing the 55% self-performance requirement. The remaining Work may be performed by qualified Subcontractor(s). 17. Bid Schedule. Each bidder must complete the Bid Schedule form with unit prices as indicated, and submit the completed Bid Schedule with its Bid Proposal. 2023 Concrete Reconstruction Project 2021 Form INSTRUCTIONS TO BIDDERS 2023-104 Page 9 17.1 Incorrect Totals. In the event a computational error for any bid item (base bid or alternate) results in an incorrect extended total for that item, the submitted base bid or bid alternate total will be adjusted to reflect the corrected amount as the product of the estimated quantity and the unit cost. In the event of a discrepancy between the actual total of the itemized or unit prices shown on the Bid Schedule for the base bid, and the amount entered as the base bid on the Bid Proposal form, the actual total of the itemized or unit prices shown on the Bid Schedule for the base bid will be deemed the base bid price. Likewise, in the event of a discrepancy between the actual total of the itemized or unit prices shown on the Bid Schedule for any bid alternate, and the amount entered for the alternate on the Bid Proposal form, the actual total of the itemized prices shown on the Bid Schedule for that alternate will be deemed the alternate price. Nothing in this provision is intended to prevent a bidder from requesting to withdraw its bid for material error under Public Contract Code § 5100 et seq. 17.2 Estimated Quantities. The quantities shown on the Bid Schedule are estimated and the actual quantities required to perform the Work may be greater or less than the estimated amount. The Contract Price will be adjusted to reflect the actual quantities required for the Work based on the itemized or unit prices provided in the Bid Schedule, with no allowance for anticipated profit for quantities that are deleted or decreased, and no increase in the unit price, and without regard to the percentage increase or decrease of the estimated quantity and the actual quantity. 18. Bidder’s Questionnaire. A completed, signed Bidder’s Questionnaire using the form provided with the Contract Documents and including all required attachments must be submitted within 48 hours following a request by City. A bid that does not fully comply with this requirement may be rejected as nonresponsive. A bidder who submits a Bidder’s Questionnaire which is subsequently determined to contain false or misleading information, or material omissions, may be disqualified as non-responsible. END OF INSTRUCTIONS TO BIDDERS )RUP7HFKQLFDO6SHFLILFDWLRQV&RQFUHWH5HFRQVWUXFWLRQ3URMHFW Addendum 1 3DJH EDFNILOODQGFOHDQXS&RQWUDFWRULVDGYLVHGWRFORVHO\UHYLHZ&LW\RI&XSHUWLQR 6WDQGDUG'HWDLOV WKURXJK6HH FLW\VWDQGDUGGHWDLOIRU GLDJUDPRISD\LWHPV %LG ,WHP ± 5HPRYDO RI 3DUN 6WULS ,PSURYHPHQWV 7KLV ZRUN LQFOXGHV EUHDNLQJ XS ORDGLQJ KDXOLQJ DQG GLVSRVLQJ RI SRUWODQG FHPHQW FRQFUHWH DVSKDOW EULFN RU RWKHU PDWHULDOV LQ DUHDV VXFK DV SDUN VWULSV ZKHUH QHZ SRUWODQGFHPHQWFRQFUHWHLVQRWWREHLQVWDOOHG7KLVZRUNVKDOODOVRLQFOXGH EDFNILOOLQJDQGVPRRWKLQJRXWWRSVRLOWRDSODQHHYHQZLWKWRSRIFXUEDQGWRS RIVLGHZDON %LG ,WHP 9DOOH\ *XWWHU 7KLV ZRUN VKDOO LQFOXGH WKH UHPRYDO RI H[LVWLQJ YDOOH\ JXWWHU UHPRYDO RI VWUHHW SDYHPHQW LI QHFHVVDU\ JUDGLQJ ILOOLQJ DQG FRPSDFWLRQRIERWKVXEEDVHDQGEDVHPDWHULDOLIQHFHVVDU\DQGFRQVWUXFWLRQ RIQHZYDOOH\ JXWWHU3RUWODQGFHPHQWFRQFUHWHVKDOOEH DVVSHFLILHG DERYH DQGVKDOOLQFOXGHUHEDUSHU&LW\6WDQGDUG'HWDLO %LG,WHP$±*±'HSUHVVHG&XUE5DPSV7KLVZRUNVKDOOLQFOXGHVDZFXW DQG UHPRYDO RI H[LVWLQJ LPSURYHPHQWV, removal of street pavement as necessary, WKH FRQVWUXFWLRQ RI VXEJUDGH SODFHPHQW RI FXVKLRQ PDWHULDO DQG FRQVWUXFWLRQ RI QHZ KDQGLFDS UDPS DW YDULRXVORFDWLRQVSHU&DOWUDQV6WDQGDUG'HWDLO$$ODWHVWDGGLWLRQDQGLQ FRQIRUPDQFHZLWK$'$UHTXLUHPHQWV7KH(QJLQHHUVKDOOGHWHUPLQHWKHW\SH RIUDPSWREHLQVWDOOHGDWHDFKORFDWLRQ:RUNVKDOOLQFOXGHDOOLPSURYHPHQWV ZLWKLQUDPSERDUGHUVLQFOXGLQJ DGMDFHQWFXUE JXWWHU DVVKRZQRQ GHWDLO $$DVVXPLQJSODQWHUZLGWKUDQJLQJ¶WR¶3D\PHQWVKDOOEHRQSHU HDFKEDVLV&DVHW\SH%VKDOOKDYHDPD[LPXPDUHDRIVTXDUHIHHW,ID W\SH%UDPSH[FHHGVVTXDUHIHHWWKHDGGLWLRQDOVTXDUHIRRWDJHZLOOEH SDLG DW WKH XQLW FRVW IRU UHPRYDOUHSODFHPHQW RI VLGHZDON 'HSUHVVHG FXUE UDPSVVKDOOEHSRXUHGPRQROLWKLFDOO\ZLWKDGMDFHQWFXUEDQGJXWWHUUHWDLQLQJ FXUEVHWF$OOLPSURYHPHQWVRXWVLGHRIWKHUDPSERUGHUVLQFOXGLQJVLGHZDON FXUEDQGJXWWHUDQGUHWDLQLQJFXUEVEHKLQGZDONFDVHW\SH%DQG&VKDOO EHSDLGDWXQLWFRVW5HWDLQLQJFXUEVDGMDFHQWWRSODQWLQJDUHDV&DVH7\SH () *VKDOOEHLQFOXGHGLQXQLWFRVWWRFRQVWUXFWUDPS6HHDWWDFKHGGHWDLO $$IRULOOXVWUDWLRQRISD\LWHPV+DUGVFDSHLQSODQWHUVWULSDGMDFHQWWRFXUE UDPSVVKDOOEHUHPRYHGWROLPLWVVSHFLILHGE\HQJLQHHUSULRUWRLQVWDOODWLRQRI UDPSDQGVKDOOEHSDLGSHUELGLWHP7KH color of GHWHFWDEOH ZDUQLQJ Vurface VKDOOEHIHGHUDO\HOORZ. %LG ,WHP ± 8SJUDGH ([LVWLQJ &XUE 5DPS 7KLV ZRUN ZLOO PRGLI\ H[LVWLQJ UDPSVWRFRPSO\ZLWK&DOWUDQV6WDQGDUG'HWDLO$$ODWHVWDGGLWLRQ:RUN VKDOO LQFOXGH LQVWDOODWLRQ RI GHWHFWDEOH ZDUQLQJ VXUIDFHV &RQWUDFWRU VKDOO YHULI\ H[LVWLQJ UDPSV PHHW DOO $'$ UHTXLUHPHQWV RWKHU WKDQ SUHVHQFH RI GHWHFWDEOH ZDUQLQJ VXUIDFH SULRU WR LQVWDOODWLRQ 7KH GHWHFWDEOH ZDUQLQJ VXUIDFHVKDOOH[WHQGWKHIXOOZLGWKDQGWKUHHIRRWGHSWKRIWKHUDPSDQGVKDOO EHORFDWHG´WR´IURPWKHJXWWHUIORZOLQH7KHGHWHFWDEOHZDUQLQJVXUIDFH VKDOOEHIHGHUDO\HOORZDVVSHFLILHGE\WKH&LW\(QJLQHHUFRPSRVLWHWDFWLOHE\ $'$VROXWLRQV,QFRUDSSURYHGHTXDO:KHQWKHGHWHFWDEOHZDUQLQJVXUIDFH HGJHLVFXWDQGWKHUHVXOWLQJHGJHLVQRWIOXVKZLWKWKHVXUIDFHRIWKHUDPS WKH HGJH VKDOO EH EHYHOHG RU FRQIRUPHG ZLWK SHULPHWHU VHDODQW DW PD[ )RUP7HFKQLFDO6SHFLILFDWLRQV&RQFUHWH5HFRQVWUXFWLRQ3URMHFW Addendum 1 3DJH VORSH LQ DFFRUGDQFH ZLWK WKH PDQXIDFWXUHV UHTXLUHPHQWV &RORU 0DWFKHG VWUXFWXUDO DGKHVLYH VKDOO EH 8UHWKDQH (ODVWRPHULF $GKHVLYH E\ %RVWLN RU DSSURYHG HTXDO 6WUXFWXUDO DGKHVLYH VKDOO EHDSSOLHG WRIXOO SHULPHWHU DQG WKURXJK FHQWHU RI WLOH HDFK ZD\ SHU PDQXIDFWXUHV UHTXLUHPHQWV &RORU PDWFKHGVWDLQOHVVVWHHOIODWKHDGGULYHDQFKRUV´GLDPHWHU[ò´ ORQJVKDOOEHSODFHGWZHOYHLQFKRQFHQWHUERWKGLUHFWLRQV0DQXIDFWXUHUV VKDOOSURYLGHDZULWWHQ\HDUZDUUDQW\IRUSUHIDEULFDWHGGHWHFWDEOHZDUQLQJ VXUIDFHV JXDUDQWHHLQJ UHSODFHPHQW ZKHQ WKHUH LV D GHIHFW LQ WKH GRPH VKDSH FRORU IDVWQHVV VRXQGRQFDQH DFRXVWLF TXDOLW\ UHVLOLHQFH RU DWWDFKPHQW:DUUDQW\SHULRGVKDOOEHJLQXSRQDFFHSWDQFHRIZRUN %LG,WHP±&XUE5DPS5HWDLQLQJ&XUEEHKLQGZDON3D\PHQWVKDOOEH PDGHSHUOLQHDUIRRWRIUHWDLQLQJFXUELQVWDOOHG3D\PHQWVKDOOLQFOXGHIXOO FRPSHQVDWLRQIRUIXUQLVKLQJDOOODERUPDWHULDOVWRROVHTXLSPHQWDQG LQFLGHQWDOV %LG,WHP5RRW%DUULHUV3D\PHQWVKDOOEHPDGHSHUOLQHDUIRRWRIURRW EDUULHULQVWDOODWLRQ3D\PHQWVKDOOLQFOXGHH[FDYDWLQJWKHUHTXLUHGWUHQFKDQG WKHIXUQLVKLQJRIDOOODERUPDWHULDOVWRROVDQGHTXLSPHQWUHTXLUHGWRURRW SUXQHDSSO\GUHVVLQJDQGLQVWDOOURRWEDUULHUFRPSOHWHDQGLQSODFH %LG,WHP0HGLDQ,VODQG&XUE3D\PHQWVKDOOLQFOXGHUHPRYDORIH[LVWLQJ LPSURYHPHQWVUHPRYDORIVWUHHWSDYHPHQWLIQHFHVVDU\JUDGLQJILOOLQJDQG FRQVROLGDWLQJRIEDVHPDWHULDOV7KLVZRUNVKDOODOVRLQFOXGHEDFNILOOLQJDQG UHSODFHPHQWRIWRSVRLOVLQODQGVFDSHPHGLDQLVODQGVSURWHFWLRQLQSODFHRU UHSODFHPHQWRIH[LVWLQJLUULJDWLRQIDFLOLWLHVUHFRQILJXUDWLRQRUPRGLILFDWLRQRI LUULJDWLRQIDFLOLWLHVLIQHHGHGZLOOEHGRQHE\RWKHUVFRQWUDFWRUVKDOOVXSSO\ WUDIILFFRQWURODQGDGYDQFHZDUQLQJGHYLFHVIRUODQHFORVXUHV 3D\PHQWVKDOOEHPHDVXUHGDQGSDLGSHUOLQHDUIRRWIRUPHGLDQLVODQGFXUEV SHU&LW\6WDQGDUG'HWDLO$3D\PHQWVKDOOLQFOXGHIXOOFRPSHQVDWLRQIRU IXUQLVKLQJDOOODERUPDWHULDOVWRROVHTXLSPHQWDQGLQFLGHQWDOVDQGIRU UHWXUQLQJVHUYLFHDEOHH[LVWLQJVHJPHQWHGFXUEVWRWKH&LW\RUGLVSRVLQJRI QRQVHUYLFHDEOHH[LVWLQJFXUEV/RFDWLRQVRIPHGLDQLVODQGVLPSURYHPHQWV VKDOOEHGHWHUPLQHGE\WKH(QJLQHHU3D\PHQWVKDOOLQFOXGHIXOO FRPSHQVDWLRQIRUIXUQLVKLQJDOOODERUPDWHULDOVLQFOXGLQJVDQGFXVKLRQ WRROVHTXLSPHQWDQGLQFLGHQWDOV &LW\ZLOOEHUHVSRQVLEOHIRUUHORFDWLRQRIDQ\WUDIILFFRQWUROSRVWVLJQVWKDWPD\ EHORFDWHGZLWKLQPHGLDQLVODQGV %LG,WHP5HFRQVWUXFWLRQRI&DWFK%DVLQ7RS3D\PHQWVKDOOEHPDGHIRU WKHUHPRYDODQGUHSODFHPHQWRIH[LVWLQJFDWFKEDVLQWRSSHU&LW\6WDQGDUG 'HWDLO H[LVWLQJ KRRG IUDPH DQG JUDWH VKDOO EH VDOYDJHG DQG UHXVHG UHSODFHPHQWRIH[LVWLQJUHEDUVKDOOEHLQFOXGHGLQWKH%LG,WHP %LG,WHP±$VSKDOW5HSODFHPHQW3D\PHQWVKDOOEHPHDVXUHGDQGSDLG SHUWKHWKHRUHWLFDOZHLJKWPHDVXUHGLQWRQV7KHWKHRUHWLFDOZHLJKWZLOOEH FDOFXODWHGEDVHGXSRQWKHLQGLYLGXDODVSKDOWUHSODFHPHQWDUHDVPDUNHGE\ )RUP7HFKQLFDO6SHFLILFDWLRQV&RQFUHWH5HFRQVWUXFWLRQ3URMHFW Addendum 1 Project # 3DJH WKH&LW\PXOWLSOLHGE\WKHGHSWKPXOWLSOLHGE\WKHZHLJKWRIDVSKDOWLQOEFXELF IHHWDVVXPHOEVFXELFIRRWDOOGLYLGHGE\3D\PHQWVKDOOLQFOXGH IXOO FRPSHQVDWLRQ IRU IXUQLVKLQJ DOO ODERU PDWHULDOV WRROV HTXLSPHQW DQG LQFLGHQWDOV DQG IRU GRLQJ DOO WKH ZRUN LQYROYHG LQ FRQVWUXFWLQJ WKH DVSKDOW UHSDLUV FRPSOHWH LQSODFH VDZFXWWLQJ UHPRYDO RI DVSKDOWEDVHURFNHDUWK VSRLOV LQFOXGLQJ DQ\ DQG DOO DGGLWLRQDO ZRUN GHVFULEHG LQ WKHVH SURMHFW VSHFLILFDWLRQVDQGSODQV$Q\DQGDOOUHPRYDODQGUHSODFHPHQWGRQHRXWVLGH RI WKH DUHDV PDUNHG E\ WKH &LW\ RU WR GHSWKV JUHDWHU WKDQ WKH UHTXLUHG LQFKHV &RQWUDFWRU LV UHTXLUHG WR FRRUGLQDWH FRQVWUXFWLRQ ZLWK Aldo Corral 3XEOLF :RUNV,QVSHFWRUDPLQLPXPRIKRXUVLQDGYDQFH 3D\PHQWVKDOOEHPDGHIRURQO\WKRVHLWHPVVKRZQRQWKHELGVFKHGXOH$Q\ LWHP RI ZRUN WKDW LV QRW VKRZQ RQ ELG VFKHGXOH EXW LV UHTXLUHG E\ WKHVH VSHFLILFDWLRQV VKDOO EH FRQVLGHUHG DV LQFLGHQWDO DQG IXOO FRPSHQVDWLRQ IRU VDPHVKDOOEHPDGHDVFRQVLGHUHGLQFOXGHGLQWKHSD\PHQWIRUWKHELGLWHPV ,QJHQHUDOFRQWUDFWSULFHVDQGSD\PHQWVVKDOOLQFOXGHEXWQRWEHOLPLWHGWR IXOOFRPSHQVDWLRQIRUDOOQHFHVVDU\PDWHULDOVODERUWRROVHTXLSPHQWWUDIILF FRQWURODQGLQFLGHQWDOVWRGRDOOWKHZRUNLQYROYHGFRPSOHWHDQGLQSODFHDV VKRZQRQWKHSODQVDVVSHFLILHGLQWKHVSHFLILFDWLRQVDQGDVGLUHFWHGE\WKH (QJLQHHU /,672)'(7$,/6 'HWDLO1R7LWOH 67$1'$5'&85%6(&7,216 67$1'$5'9$//(<*877(5 6,'(:$/.6'(7$,/6 '5,9(:$<'(7$,/±'(7$&+('6,'(:$/. '5,9(:$<'(7$,/±0212/,7+,&6,'(:$/. %'5,9(:$<'(7$,/±0212/,7+,&6,'(:$/.237,21 '2:(/&211(&7,216 67$1'$5''523,1/(7±&85%23(1,1* $$&$/75$165(9,6('67$1'$5'3/$1±&85%5$03 '(7$,/6 2023 Concrete Reconstruction Project Partial Location List Address Street Name Remove Parkstrip (SF) Sidewalk (SF) Curb & Gutter (LF) Driveway (SF) ADA Ramp (EA) Reconstruct Catch Bason (EA) Retaining Curb (LF) Valley Gutter (SF) 20644 Acadia Ct 0 297 0 0 0 0 0 0 21515 Addington Ct 0 243 54 0 0 0 0 0 10299 Ainsworth 0 108 0 0 0 0 0 0 22539 Alcalde Rd 18 130.5 0 0 0 0 0 0 10314 Ann Arbor Ave 0 0 0 0 1 0 22 0 10315 Ann Arbor Ave 0 0 0 0 1 0 24 0 10500 Ann Arbor Ave 0 306 94 139.5 0 0 0 0 10446 Anson Ave 0 121.5 0 0 0 0 0 0 10486 Anson Ave 0 54 0 0 0 0 0 0 1529 Aster LN 0 0 0 45.6 0 0 0 0 10125 Bandley Dr 0 60 0 126 0 0 0 0 10250 Bandley Dr 0 100 8 0 0 0 0 0 10268 Bandley Dr 0 0 0 0 1 0 0 0 10385 Bandley Dr 0 81 4.5 0 0 0 0 0 10441 Bandley Dr 0 0 0 122 0 0 0 0 10441 Bandley Dr 0 0 0 0 1 0 0 0 10443 Bandley Dr 0 69 0 588 0 0 0 0 10475 Bandley Dr 0 141.75 0 0 0 0 0 0 10475 Bandley Dr 0 0 15 0 0 0 0 0 19050 Barnhart Ave 0 96 24 0 0 0 0 0 19060 Barnhart Ave 0 120 30 105 0 0 0 0 7504 Barnhart Pl 0 63 0 0 0 0 0 0 10195 Beardon 0 34.2 0 0 0 0 0 0 11052 Bel Aire Ct 0 112.5 0 0 0 0 0 0 21815 Benetti Ct 0 58.5 0 0 0 0 0 0 858 Bette Ave 0 139.5 7 0 0 0 0 0 861 Bette Ave 0 186.75 34 195 0 0 0 0 862 Bette Ave 0 18 0 0 0 0 0 0 Page 1 Address Street Name Remove Parkstrip (SF) Sidewalk (SF) Curb & Gutter (LF) Driveway (SF) ADA Ramp (EA) Reconstruct Catch Bason (EA) Retaining Curb (LF) Valley Gutter (SF) 874 Bette Ave 0 146.25 1 175 0 0 0 0 875 Bette Ave 0 65.25 9 324 0 0 0 0 880 Bette Ave 0 119.25 34 266 0 0 0 0 889 Bette Ave 0 67.5 3 0 1 0 14 0 6149 Bollinger Rd 0 40.5 0 0 0 0 0 0 6387 Bollinger Rd 0 76.5 0 0 0 0 0 0 6393 Bollinger Rd 172.5 81 0 0 0 0 0 0 20075 Bollinger Rd 33.75 274.5 0 0 0 0 0 0 10138 Bonny Dr 0 38.25 0 0 0 0 0 0 10209 Bonny Dr 0 94.5 0 0 0 0 0 0 10281 Bonny Dr 0 99 0 0 0 0 0 0 869 Brent Ave 136.5 94.5 0 0 0 0 0 0 875 Brent Ave 0 31.5 0 0 0 0 0 0 878 Brent Ave 0 54 0 0 0 0 0 0 883 Brent Ave 0 76.5 10.5 0 1 0 14 0 10094 Bret Ave 0 220 8.5 176 0 0 0 0 10108 Bret Ave 0 24 5 154 0 0 0 0 821 Bubb Rd 0 50 0 0 1 0 18 0 945 Bubb Rd 78 0 20 0 0 0 0 0 1016 Bubb Rd 0 112.5 11 0 1 0 20 0 1052 Bubb Rd 16.25 40 0 0 0 0 0 0 1056 Bubb Rd 32.5 50 0 50 0 0 0 0 11021 Bubb Rd 0 0 12.5 0 1 0 20 0 11131 Bubb Rd 0 40.5 0 0 0 0 0 0 11141 Bubb Rd 103.5 121.5 0 0 0 0 0 0 11161 Bubb Rd 171 0 0 0 0 0 0 0 11221 Bubb Rd 99 0 0 0 1 0 0 0 11247 Bubb Rd 0 90 12 0 0 0 0 0 11257 Bubb Rd 0 0 0 207 0 0 0 0 11411 Bubb Rd 634.5 544.5 0 0 0 0 0 0 10330 Calvert Dr 0 16 0 101.75 0 0 0 0 Page 2 Address Street Name Remove Parkstrip (SF) Sidewalk (SF) Curb & Gutter (LF) Driveway (SF) ADA Ramp (EA) Reconstruct Catch Bason (EA) Retaining Curb (LF) Valley Gutter (SF) 10335 Calvert Dr 0 46 0 79.75 0 0 0 0 10340 Calvert Dr 0 16 0 50 0 0 0 0 10155 Carol Lee Dr 0 99 0 0 0 0 0 0 7731 Carriage Cir 0 49.5 0 0 0 0 0 0 22345 Carta Blanca 0 22.5 0 0 0 0 0 0 10804 Carver Dr 0 112 10 133.25 0 0 0 0 10480 Castine Ave 15.75 0 0 0 0 0 0 0 10591 Castine Ave 0 24.75 0 0 0 0 0 0 21574 Castleton Dr 189 261 30 0 0 0 0 0 11221 Catalina Ct 175.5 0 0 0 0 0 0 0 11222 Catalina Ct 0 49.5 0 0 0 0 0 0 11234 Catalina Ct 63 58.5 0 0 0 0 0 0 11235 Catalina Ct 72 117 0 0 0 0 0 0 11430 Charsan Ln 0 110 25 0 0 1 0 0 10340 Cherry Tree Ln 0 396 0 0 0 0 0 0 10416 Cherry Tree Ln 13.5 0 0 0 0 0 0 0 21023 Christenson Dr 0 0 0 0 1 0 21 0 21073 Christenson Dr 0 0 0 0 1 0 21 0 11062 Clarkston Ave 0 31.5 0 13.5 0 0 0 0 11082 Clarkston Ave 0 63 0 0 0 0 0 0 11113 Clarkston Ave 20.25 15.75 3.5 46.75 0 1 0 0 11122 Clarkston Ave 33.75 162 21.5 0 0 0 0 0 11132 Clarkston Ave 0 0 25 0 0 0 0 0 11162 Clarkston Ave 33.75 24.75 0 0 0 0 0 0 20327 Clay St 0 171.9 0 153 0 0 0 0 20337 Clay St 0 155.3 0 0 0 0 0 0 20408 Clay St 0 63 0 0 0 0 0 0 20667 Cleo Avr 0 125 25 0 0 0 0 0 20363 Cliffden Way 0 0 0 213.8 0 0 0 0 21716 Collingsworth Dr 63 112.5 0 0 0 0 0 0 21725 Collingsworth Dr 13.5 90 15 189 0 0 0 Page 3 Address Street Name Remove Parkstrip (SF) Sidewalk (SF) Curb & Gutter (LF) Driveway (SF) ADA Ramp (EA) Reconstruct Catch Bason (EA) Retaining Curb (LF) Valley Gutter (SF) 21736 Collingsworth Dr 58.5 45 0 0 0 0 0 0 21746 Collingsworth Dr 148.5 148.5 0 0 0 0 0 0 21756 Collingsworth Dr 0 0 18 0 0 0 0 0 21971 Columbus Ave 0 90 0 0 0 0 0 0 21702 Columbus Dr 0 114.75 0 0 0 0 0 0 21513 Conradia Ct 0 90 0 0 0 0 0 0 10067 Craft Ave 0 146.3 12 0 0 0 0 0 7883 Creekline Dr 0 72 12.6 0 0 0 0 0 10116 Crescent Ct 0 0 11.5 0 0 1 0 0 22371 Cupertertino Rd 0 40.5 0 0 0 0 0 0 22399 Cupertino Rd 0 216 0 140 6 0 0 0 10180 Danube Dr (Rodrigues)0 261 9.5 93.75 0 0 0 0 10202 Danube Dr (Rodrigues)0 189 0 0 0 0 0 0 10420 De Anza Blvd 50 255 35 0 0 0 0 0 10431 De Anza Blvd 0 239.25 0 0 0 0 0 0 10495 De Anza Blvd 0 110 0 0 0 0 0 0 22284 De Anza Blvd 0 0 22 0 0 0 0 0 7456 De Foe Dr 0 0 0 0 1 0 0 0 7457 De Foe Dr 0 0 0 0 1 0 0 0 7624 De Foe Dr 0 199 11.3 0 0 0 0 0 7453 De La Farge 0 0 0 0 1 0 0 0 10684 Deep Cliffe Dr 0 90 0 0 0 0 0 0 10424 Dempster 0 0 19 25 0 0 0 0 10885 Dryden Ave 0 59.8 0 0 0 0 0 0 10914 Dryden Ave 0 40 0 0 0 0 0 0 7452 Dumas Ave 0 0 0 0 1 0 0 0 7455 Dumas Ave 0 51.8 0 0 1 0 0 0 7563 Dumas Ave 0 78.75 0 0 0 0 0 0 21482 Elm Ct 74.25 186.75 0 0 1 0 22 0 7408 Fallenleaf Ln 0 63.5 0 0 1 0 0 0 7409 Fallenleaf Ln 0 81 0 0 1 0 0 0 Page 4 Address Street Name Remove Parkstrip (SF) Sidewalk (SF) Curb & Gutter (LF) Driveway (SF) ADA Ramp (EA) Reconstruct Catch Bason (EA) Retaining Curb (LF) Valley Gutter (SF) 21103 Fenway Ct 0 0 0 0 1 0 18 0 7886 Fiesta Ln 0 181.4 0 0 0 0 0 0 21558 Flintshire St 0 36 0 0 0 0 0 0 10625 Flora Vista Dr 0 0 0 0 1 0 18 0 10981 Franco Ct 0 0 49 0 0 0 0 0 21192 Gardena Ave 0 36 0 0 0 0 0 0 10638 Gardena Ct 0 24.75 0 0 0 0 0 0 21589 Grand Ave 0 45 10 0 0 0 0 0 20643 Greenleaf Dr 0 103.5 0 0 0 0 0 0 21141 Grenola Dr 0 96.75 20 0 0 0 0 0 7536 Hollandberry 0 90 0 142.4 0 0 0 0 20441 Homestead Rd 0 0 33.2 0 0 0 0 0 21866 Hyannisport Dr 0 74.7 0 0 0 0 0 0 858 Hyde Ave 0 132 10 287 0 0 0 0 866 Hyde Ave 0 166.5 31 243 0 0 0 0 867 Hyde Ave 0 42.75 35.5 144 0 0 0 0 872 Hyde Ave 0 144 0 283.5 0 0 0 0 873 Hyde Ave 0 63 3 297 0 0 0 0 880 Hyde Ave 0 16 26.5 283.5 0 0 0 0 884 Hyde Ave 0 92 41 276.75 0 0 0 0 891 Hyde Ave 0 148.5 61 96.75 0 0 0 0 892 Hyde Ave 0 193.5 29 33 0 0 0 0 898 Hyde Ave 0 198 32 203.5 0 0 0 0 906 Hyde Ave 0 72 0 0 0 0 0 0 920 Hyde Ave 0 27 0 0 0 0 0 0 928 Hyde Ave 0 103.5 18.3 301.9 0 0 0 0 1475 James Town Dr 0 0 27 175.5 0 0 0 0 22350 Janice Ave 0 0 0 37.8 0 0 0 0 22416 Janice Ave 0 22.5 0 0 0 0 0 0 20181 John Dr 0 49.5 0 0 0 0 0 0 20195 John Dr 0 112.5 0 0 0 0 0 0 Page 5 Address Street Name Remove Parkstrip (SF) Sidewalk (SF) Curb & Gutter (LF) Driveway (SF) ADA Ramp (EA) Reconstruct Catch Bason (EA) Retaining Curb (LF) Valley Gutter (SF) 10265 Judy Ave 0 76 0 0 0 0 0 0 10279 Judy Ave 0 96 0 10 0 0 0 0 22330 Kendle St 0 130.5 0 0 0 0 0 0 1117 Kentwood Dr 0 90.9 0 0 0 0 0 0 7466 Kingsbury Pl 0 92.25 0 0 0 0 0 0 7556 Kirwin Ln 0 162 0 0 0 0 0 0 7562 Kirwin Ln 0 67.5 0 0 0 0 0 0 11220 La Jolla Ct 238.5 351 0 0 0 0 0 0 10658 La Roda Dr 0 194 0 0 0 0 0 0 10388 Landsdale 60.75 72 11 0 0 0 0 0 10382 Las Ondas Way 0 0 0 59.6 0 0 0 0 21005 Lauretta Dr 0 0 0 0 1 0 18 0 21124 Lauretta Dr 0 81 8.6 0 0 0 0 0 10892 Leavelsey Pl 0 60.3 0 0 0 0 0 0 10832 Leavesley Pl 0 42.3 0 0 0 0 0 0 905 Liberty Ct 0 157.5 0 0 0 0 0 0 929 Liberty Ct 0 85.5 0 87.75 0 0 0 0 10737 Linda Vistga 85.5 40.5 0 0 0 0 0 0 21671 Lindy Ln 0 0 0 72 0 0 0 0 21681 Lindy Ln 48 121.5 0 0 0 0 0 0 21701 Lindy Ln 0 148.5 0 0 0 0 0 0 10488 Lockwood Dr 0 207 21 0 0 0 0 0 21054 Marcy Ct 0 0 0 0 1 0 21 0 21114 Marcy Ct 0 0 0 0 1 0 19 0 10734 Martinwood Way 0 130.5 20.3 102 0 0 0 0 22168 McClellan Rd 0 139.5 0 0 0 0 0 0 20094 Merritt Dr 0 58.5 0 0 0 0 0 0 20110 Merritt Dr 0 76.5 0 0 0 0 0 0 20204 Merritt Dr 0 67.5 0 0 0 0 0 0 21480 Millard Ln 0 107.5 5.5 0 1 0 17 0 21485 Millard Ln 0 102 5 0 1 0 17 40.5 Page 6 Address Street Name Remove Parkstrip (SF) Sidewalk (SF) Curb & Gutter (LF) Driveway (SF) ADA Ramp (EA) Reconstruct Catch Bason (EA) Retaining Curb (LF) Valley Gutter (SF) 21445 Millarrd Ln 0 0 14 0 0 1 0 0 10366 Miller Ave 0 117 0 338.3 0 0 0 0 10705 Minette 0 82 0 14 0 0 0 0 21595 Monrovia 0 225 0 0 0 0 0 21525 Monrovia 40.5 22.5 10 28 0 0 0 0 Monta Vista Park (foothill)0 317.3 21.5 0 0 0 0 0 Monta Vista Park (woodridge)0 677.5 5.8 0 0 0 0 0 11220 Monterey Ct 101.25 33.75 0 114 0 0 0 0 10189 N Blaney Ave 0 72 0 15.75 0 0 0 0 10168 N Portal 0 117 0 0 0 0 0 0 10185 N Stelling RD 0 0 0 0 1 0 22 0 10185 N Stelling RD 0 0 0 0 2 0 40 233.75 18910 Newsome Ave 0 54 8 16 0 0 0 0 10240 Nile Dr (Rodrigues)0 137.25 0 0 0 0 0 0 10363 Noel Ave 0 123.8 0 0 0 0 0 0 10412 Noel Ave 4.3 0 0 0 0 0 0 0 10432 Noel Ave 0 67.5 0 0 0 0 0 0 10356 Norwich Ave 0 31.5 0 67.5 0 0 0 0 1024 November Dr 0 153 0 0 0 0 0 0 1025 November Dr 0 88.4 0 0 0 0 0 0 1075 November Dr 0 45 0 0 0 0 0 0 1077 November Dr 0 49.5 0 0 0 0 0 0 1092 November Dr 0 42.5 0 0 0 0 0 0 1095 November Dr 0 114.75 0 0 0 0 0 0 23505 Oak Valley Rd 0 49.5 0 0 0 0 0 0 10219 Palo Vist Rd 0 76.5 0 0 0 0 0 0 10162 Park Cir E 0 22.5 0 0 0 0 0 0 20650 Park Circle E 0 83.3 0 0 0 0 0 0 10225 Parkside Ln 0 21.6 0 0 0 0 0 0 20996 Pepper Tree Ln 0 45 6 0 0 0 0 0 10321 Phar Lap Dr 0 108 0 0 0 0 0 0 Page 7 Address Street Name Remove Parkstrip (SF) Sidewalk (SF) Curb & Gutter (LF) Driveway (SF) ADA Ramp (EA) Reconstruct Catch Bason (EA) Retaining Curb (LF) Valley Gutter (SF) 10421 Phar Lap Dr 0 126 0 0 0 0 0 0 20269 Pinntage Way 0 94.5 0 0 0 0 0 0 10266 Plum Tree Ln 0 55.4 0 0 0 0 0 0 1648 Primrose Way 0 142.2 0 0 0 0 0 0 8045 Pumpkin Dr 0 103.5 13.5 0 1 0 20 0 7395 Rainbow Dr 0 121 0 319 0 0 0 0 7603 Rainbow Dr 120 101.25 31 125 0 0 0 0 7925 Rainbow Dr 0 130.5 0 0 0 0 0 0 7941 Rainbow Dr 0 155.25 9.5 84 0 0 0 0 21640 Rainbow Dr 0 0 22 0 0 1 0 0 18615 Ralya 0 32 15 48 0 0 0 0 22486 Rancho Ventura St 0 45 0 0 0 0 0 0 18605 Rayla Ct 0 50 12.5 0 0 0 0 0 21502 Regnart Rd 0 0 0 0 1 0 0 0 21502 Regnart Rd 0 189 15.5 144 0 0 0 0 21512 Regnart Rd 193.5 40.5 39 0 0 0 0 0 21522 Regnart Rd 0 40.5 31 0 0 0 0 0 21532 Regnart Rd 0 49.5 0 0 0 0 0 0 21541 Regnart Rd 0 45 43 0 0 0 0 0 21551 Regnart Rd 0 0 0 63 0 0 0 0 21591 Regnart Rd 81 121.5 20 59.5 0 0 0 0 22344 Riverside Dr 0 171 0 0 0 0 0 0 22353 Riverside Dr 256.5 364.5 65 190 0 0 0 0 7778 Robindell Way 0 126 0 0 0 0 0 0 20100 Rodrigues 0 67.5 0 105 0 0 0 0 20232 Rodrigues 0 229.5 0 0 0 0 0 0 19871 Rodrigues Ave 0 72 0 0 0 0 0 0 19887 Rodrigues Ave 0 53.41 0 0 0 0 0 0 7375 Rollingdell Dr 0 215 0 174.8 0 0 0 0 21638 Rosario Ave 22.5 39.6 0 0 0 0 0 0 829 Rose Blossom Dr 0 168.75 0 0 0 0 0 0 Page 8 Address Street Name Remove Parkstrip (SF) Sidewalk (SF) Curb & Gutter (LF) Driveway (SF) ADA Ramp (EA) Reconstruct Catch Bason (EA) Retaining Curb (LF) Valley Gutter (SF) 924 Rose Blossom Dr 0 121.5 0 0 0 0 0 0 1328 Rose Garden Ln 0 195 0 0 0 0 0 0 22706 Royal Oak Dr 0 65.25 14 0 0 0 0 0 21889 Rucker Dr 0 234 0 0 0 0 0 0 21336 Rumford Dr 0 0 23.03 0 0 0 0 0 10650 S Bubb Rd 0 60.75 0 0 0 0 0 0 11061 S Bubb Rd 0 0 12 0 1 0 18 0 1121 S Stelling Rd 105 45 0 0 0 0 0 0 10175 S Tantau Ave 0 87.2 0 0 1 0 0 0 10466 S Tantau Ave 0 102 0 0 0 0 0 0 10478 S Tantau Ave 0 88 0 0 0 0 0 0 10696 S Tantau Ave 0 145.2 24.3 32.8 0 0 0 0 10708 S Tantau Ave 0 64 8 0 0 0 0 0 22481 S Walnut Cir 74.25 101.25 0 240 0 0 0 0 10554 San Leandro Ave 0 99 0 67.5 0 0 0 0 10590 San Leandro Ave 0 0 38 90 0 0 0 0 22385 Santa Paula Ave 0 81 0 0 0 0 0 0 10332 Scenic Cir 0 68.6 0 0 0 0 0 0 10434 Scenic Ct 0 20.25 0 93.75 0 0 0 0 10454 Scenic Ct 0 49.5 11 0 0 0 0 0 20745 Scofield Dr 0 0 12 0 0 0 0 0 7728 Seeber Ct 0 0 0 108 0 0 0 0 1006 September Dr 0 49.5 0 0 0 0 0 0 1010 September Dr 0 137.3 0 129 0 0 0 0 1018 September Dr 0 0 0 246.8 0 0 0 0 21001 Seven Springs Pkwy 0 99 27 0 0 0 0 0 21484 Shannon Ct 0 27 0 0 0 0 0 0 21907 Shattuck Dr 0 92.25 0 0 0 0 0 0 10619 Shelly Dr 0 127.4 0 0 0 0 0 0 20619 Shelly Dr 0 127.4 0 0 0 0 0 0 10377 Somerset Ct 0 117 0 0 0 0 0 0 Page 9 Address Street Name Remove Parkstrip (SF) Sidewalk (SF) Curb & Gutter (LF) Driveway (SF) ADA Ramp (EA) Reconstruct Catch Bason (EA) Retaining Curb (LF) Valley Gutter (SF) 20101 Somerset Dr 39 83.25 0 0 0 0 0 0 20115 Somerset Dr 15 74.25 0 114 0 0 0 0 20143 Somerset Dr 0 119.25 0 0 0 0 0 0 20163 Somerset Dr 0 153 0 0 0 0 0 0 20183 Somerset Dr 0 45.5 0 0 0 0 0 0 7716 Squirehill Ct 0 69.75 0 0 0 0 0 0 850 Stendhal Ln 0 147 0 0 0 0 0 0 728 Stendhall Ln 0 0 10 0 0 0 0 0 734 Stendhall Ln 0 0 11.8 0 0 0 0 0 10324 Sterling Blvd 0 184 57 44 0 0 0 0 10340 Sterling Blvd 0 116 41 48 0 0 0 0 10069 Stern Ave 0 0 0 88 0 0 0 0 10081 Stern Ave 0 148 37 110 0 0 0 0 19590 Stevens Creek Blvd 69.75 152.5 0 0 0 0 0 0 19625 Stevens Creek Blvd 0 46.5 0 0 0 0 0 0 20289 Stevens Creek Blvd 0 117.5 0 0 0 0 0 0 20301 Stevens Creek Blvd 0 0 7 53.72 0 0 0 0 20573 Stevens Creek Blvd 0 100 21 0 0 0 0 0 21530 Stevens Creek Blvd 0 112.5 24.5 80 0 0 0 0 21710 Stevens Creek Blvd 0 276 58 26 0 0 0 0 22510 Stevens Creek Blvd 0 130 2 81 0 0 0 0 10321 Stokes Ave 0 184.5 0 0 0 0 0 0 10411 Stokes Ave 0 49.5 0 0 0 0 0 0 10471 Stokes Ave 0 22.5 0 22.5 0 0 0 0 10530 Stokes Ave 0 0 0 85.5 0 0 0 0 20011 Suisun Dr 0 0 17 142.5 0 0 0 0 7969 Sunderland Dr 0 67.5 0 0 0 0 0 0 11158 Sutherland Ave 0 85.5 30.5 0 0 0 0 0 21543 Terrace Ave 50 99 0 0 0 0 0 0 21557 Terrace Ave 0 139.5 0 15.75 0 0 0 0 21739 Terrace Ave 0 36 0 0 0 0 0 0 Page 10 Address Street Name Remove Parkstrip (SF) Sidewalk (SF) Curb & Gutter (LF) Driveway (SF) ADA Ramp (EA) Reconstruct Catch Bason (EA) Retaining Curb (LF) Valley Gutter (SF) 21599 Terrace Dr 0 139.5 0 0 0 0 0 0 21669 Terrace Dr 63 0 0 0 0 0 0 0 19190 Tilson Ave 0 64 12 96 0 0 0 0 19270 Tilson Ave 0 80 16 104 0 0 0 0 7652 Tiptoe Ln 0 0 9.5 182 0 0 0 0 1021 Tuscany Pl 0 81 20.6 146.6 0 0 0 0 19948 Twilight Ct 0 103.5 0 0 0 0 0 0 11583 Upland Way 0 136.8 16.5 0 0 0 0 0 11590 Upland Way 0 0 0 11.25 0 0 0 0 20650 Valley Green Dr 0 50 39.5 0 0 0 0 0 20975 Valley Green Dr 110.25 83.25 0 0 0 0 0 0 10250 Vicksburg 0 155.7 0 0 0 0 0 0 10325 Vicksburg 148.5 0 0 0 0 0 0 0 19711 Vicksburg 0 0 28.5 0 0 0 0 0 10124 Vista Dr 0 45 0 0 0 0 0 0 10144 Vista Dr 0 63 0 0 0 0 0 0 10324 Vista Dr 0 171 0 0 0 0 0 0 10401 Vista Dr 0 211.5 20 0 1 0 17 0 10446 Vista Dr 47.25 103.5 5.5 0 1 0 20 0 10310 Walnut Cir 0 117.5 0 0 0 0 0 0 22420 Walnut Cir 24.9 260.1 0 0 0 0 0 0 1013 Westlynn 0 0 10.6 0 1 0 0 0 1048 Westlynn 0 83.3 0 0 1 0 0 0 1052 Westlynn 0 76.1 0 0 0 0 0 0 1209 Weymoth Dr 0 94.5 0 245 0 0 0 0 1217 Weymoth Dr 52 63 0 0 0 0 0 0 1248 Weymoth Dr 0 45 0 0 0 0 0 0 20093 Wheaton 0 61.6 0 0 0 0 0 0 11102 Wilkinson Ave 72 0 0 0 0 0 0 0 1181 Yorkshire Ct 0 49.5 19 49.5 0 0 0 0 1185 Yorkshire Ct 0 0 4.5 13.5 0 0 0 0 Page 11 Address Street Name Remove Parkstrip (SF) Sidewalk (SF) Curb & Gutter (LF) Driveway (SF) ADA Ramp (EA) Reconstruct Catch Bason (EA) Retaining Curb (LF) Valley Gutter (SF) 1189 Yorkshire Ct 0 0 12.5 0 0 0 0 0 1203 Yorkshire Dr 0 90 0 0 0 0 0 0 TOTAL 4642.95 29936.61 2283.93 12092.87 45 5 475 274.25 Page 12 &RQFUHWH5HFRQVWUXFWLRQ3URMHFW)RUP%,'352326$/ 3DJH %LG3URSRVDO &RQFUHWH5HFRQVWUXFWLRQ3URMHFW BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB³%LGGHU´KHUHE\VXEPLWVWKLV%LG 3URSRVDOWR&LW\RI&XSHUWLQR³&LW\´IRUWKHDERYHUHIHUHQFHGSURMHFW³3URMHFW´LQUHVSRQVHWRWKH1RWLFH ,QYLWLQJ%LGVDQGLQDFFRUGDQFHZLWKWKH&RQWUDFW'RFXPHQWVUHIHUHQFHGLQWKH1RWLFH %DVH%LG%LGGHUSURSRVHVWRSHUIRUPDQGIXOO\FRPSOHWHWKH:RUNIRUWKH3URMHFWDVVSHFLILHGLQ WKH&RQWUDFW'RFXPHQWVZLWKLQWKHWLPHUHTXLUHGIRUIXOOFRPSOHWLRQRIWKH:RUNLQFOXGLQJDOOODERU PDWHULDOVVXSSOLHVDQGHTXLSPHQWDQGDOORWKHUGLUHFWRULQGLUHFWFRVWVLQFOXGLQJEXWQRWOLPLWHGWR WD[HVLQVXUDQFHDQGDOORYHUKHDGIRUWKHIROORZLQJSULFH³%DVH%LG´ BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB $GGHQGD%LGGHUDJUHHVWKDWLWKDVFRQILUPHGUHFHLSWRIRUDFFHVVWRDQGUHYLHZHGDOODGGHQGD LVVXHGIRUWKLV%LG%LGGHUZDLYHVDQ\FODLPVLWPLJKWKDYHDJDLQVWWKH&LW\EDVHGRQLWVIDLOXUHWR UHFHLYHDFFHVVRUUHYLHZDQ\DGGHQGDIRUDQ\UHDVRQ%LGGHUVSHFLILFDOO\DFNQRZOHGJHVUHFHLSWRI WKHIROORZLQJDGGHQGD $GGHQGXP 'DWH5HFHLYHG $GGHQGXP 'DWH5HFHLYHG BBBBBBBBBBBBB BBBBBBBBBBBBB BBBBBBBBBBBBB BBBBBBBBBBBBB BBBBBBBBBBBBB BBBBBBBBBBBBB BBBBBBBBBBBBB BBBBBBBBBBBBB %LGGHU¶V&HUWLILFDWLRQVDQG:DUUDQWLHV%\VLJQLQJDQGVXEPLWWLQJWKLV%LG3URSRVDO%LGGHU FHUWLILHVDQGZDUUDQWVWKHIROORZLQJ ([DPLQDWLRQRI&RQWUDFW'RFXPHQWV%LGGHUKDVWKRURXJKO\H[DPLQHGWKH&RQWUDFW 'RFXPHQWVDQGUHSUHVHQWVWKDWWRWKHEHVWRI%LGGHU¶VNQRZOHGJHWKHUHDUHQRHUURUV RPLVVLRQVRUGLVFUHSDQFLHVLQWKH&RQWUDFW'RFXPHQWVVXEMHFWWRWKHOLPLWDWLRQVRI3XEOLF &RQWUDFW&RGH ([DPLQDWLRQRI:RUNVLWH%LGGHUKDVKDGWKHRSSRUWXQLW\WRH[DPLQHWKH:RUNVLWHDQG ORFDOFRQGLWLRQVDWWKH3URMHFWORFDWLRQ %LGGHU5HVSRQVLELOLW\%LGGHULVDUHVSRQVLEOHELGGHUZLWKWKHQHFHVVDU\DELOLW\FDSDFLW\ H[SHULHQFHVNLOOTXDOLILFDWLRQVZRUNIRUFHHTXLSPHQWDQGUHVRXUFHVWRSHUIRUPRUFDXVHWKH :RUNWREHSHUIRUPHGLQDFFRUGDQFHZLWKWKH&RQWUDFW'RFXPHQWVDQGZLWKLQWKH&RQWUDFW 7LPH 5HVSRQVLELOLW\IRU%LG%LGGHUKDVFDUHIXOO\UHYLHZHGWKLV%LG3URSRVDODQGLVVROHO\ UHVSRQVLEOHIRUDQ\HUURUVRURPLVVLRQVFRQWDLQHGLQLWVFRPSOHWHG%LG$OOVWDWHPHQWVDQG LQIRUPDWLRQSURYLGHGLQWKLV%LG3URSRVDODQGHQFORVXUHVDUHWUXHDQGFRUUHFWWRWKHEHVWRI %LGGHU¶VNQRZOHGJH 1RQGLVFULPLQDWLRQ,QSUHSDULQJWKLV%LGWKH%LGGHUKDVQRWHQJDJHGLQGLVFULPLQDWLRQ DJDLQVWDQ\SURVSHFWLYHRUSUHVHQWHPSOR\HHRU6XEFRQWUDFWRURQJURXQGVRIUDFHFRORU DQFHVWU\QDWLRQDORULJLQHWKQLFLW\UHOLJLRQVH[VH[XDORULHQWDWLRQDJHGLVDELOLW\RUPDULWDO VWDWXV ,UDQ&RQWUDFWLQJ$FW,IWKH&RQWUDFW3ULFHH[FHHGV%LGGHULVQRWLGHQWLILHGRQD OLVWFUHDWHGXQGHUWKH,UDQ&RQWUDFWLQJ$FW3XEOLF&RQWUDFW&RGHHWVHTWKH³$FW´ R&S Construction Management, Inc 03/13/2023 1,378,793.40 &RQFUHWH5HFRQVWUXFWLRQ3URMHFW)RUP%,'6&+('8/( 3DJH %LG6FKHGXOH 7KLV%LG6FKHGXOHPXVWEHFRPSOHWHGLQLQNDQGLQFOXGHGZLWKWKHVHDOHG%LG3URSRVDO3ULFLQJPXVWEH SURYLGHGIRUHDFK%LG,WHPDVLQGLFDWHG,WHPVPDUNHG³6:´DUH6SHFLDOW\:RUNWKDWPXVWEHSHUIRUPHG E\DTXDOLILHG6XEFRQWUDFWRU7KHOXPSVXPRUXQLWFRVWIRUHDFKLWHPPXVWEHLQFOXVLYHRIDOOFRVWV ZKHWKHUGLUHFWRULQGLUHFWLQFOXGLQJSURILWDQGRYHUKHDG7KHVXPRIDOODPRXQWVHQWHUHGLQWKH³([WHQGHG 7RWDO$PRXQW´FROXPQPXVWEHLGHQWLFDOWRWKH%DVH%LGSULFHHQWHUHGLQ6HFWLRQRIWKH%LG3URSRVDO IRUP $/ $OORZDQFH &) &XELF)HHW &< &XELF<DUG ($ (DFK/% 3RXQGV /) /LQHDU)RRW /6 /XPS6XP 6) 6TXDUH)HHW 721 7RQOEV %,' ,7(0 12 ,7(0'(6&5,37,21(6747<81,781,7 &267 (;7(1'(' 727$/$02817 5HPRYHDQG5HSODFH6LGHZDON6) 5HPRYHDQG5HSODFH'ULYHZD\ $SSURDFK6) 5HPRYHDQG5HSODFH&XUEDQG *XWWHU 'HWDLO 7\SH $ RU7\SH(/) 5HPRYH 3DUN 6WULS ,PSURYHPHQWV6) 9DOOH\*XWWHU6) $&XUE5DPS$$7\SH$($ %&XUE5DPS$$7\SH%($ &&XUE5DPS$$7\SH&($ '&XUE5DPS$$7\SH'($ (&XUE5DPS$$7\SH(($ )&XUE5DPS$$7\SH)($ *&XUE5DPS$$7\SH*($ 8SJUDGH([LVWLQJ5DPSV($ 5HWDLQLQJ&XUE/) 5RRW%DUULHU/) 0HGLDQ,VODQG&XUE&LW\'HWDLO/) 5HFRQVWUXFW&DWFK%DVLQ($ 5HPRYH5HSODFH$VSKDOW721 727$/%$6(%,' ,WHPVWKURXJKBBBBBLQFOXVLYHBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 1RWH7KHDPRXQWHQWHUHGDVWKH³7RWDO%DVH%LG´VKRXOGEHLGHQWLFDOWRWKH%DVH%LGDPRXQWHQWHUHGLQ 6HFWLRQRIWKH%LG3URSRVDOIRUP %,''(51$0(BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB R&S Construction Management, Inc 12 13.95 503,901.90 16.00 237,152.00 2.00 11,392.00 25.00 8,887.50 3,650.00 36,500.00 475.00 950.00 19.00 11,590.00 5.00 6,100.00 28.00 6,020.00 1,000.00 6,000.00 350.00 170,800.00 60.00 160,500.00 3,650.00 36,500.00 3,650.00 36,500.00 3,650.00 36,500.00 3,650.00 36,500.00 3,650.00 36,500.00 3,650.00 36,500.00 1,378,793.40 &RQFUHWH5HFRQVWUXFWLRQ3URMHFW)RUP%,'6&+('8/( 3DJH (1'2)%,'6&+('8/( &RQFUHWH5HFRQVWUXFWLRQ3URMHFW)RUP68%&2175$&725/,67 3DJH 6XEFRQWUDFWRU/LVW )RUHDFK6XEFRQWUDFWRUWKDWZLOOSHUIRUPDSRUWLRQRIWKH:RUNLQDQDPRXQWLQH[FHVVRIRQHKDOI RIRIWKH%LGGHU¶VWRWDO&RQWUDFW3ULFHWKHELGGHUPXVWOLVWDGHVFULSWLRQRIWKH:RUNWKH QDPHRIWKH6XEFRQWUDFWRULWV&DOLIRUQLDFRQWUDFWRUOLFHQVHQXPEHUWKHORFDWLRQRILWVSODFHRI EXVLQHVVLWV',5UHJLVWUDWLRQQXPEHUDQGWKHSRUWLRQRIWKH:RUNWKDWWKH6XEFRQWUDFWRULV SHUIRUPLQJEDVHGRQDSHUFHQWDJHRIWKH%DVH%LGSULFH '(6&5,37,21 2):25. 68%&2175$&725 1$0( &$/,)251,$ &2175$&725 /,&(16(12 /2&$7,212) %86,1(66 ',55(*123(5&(17 2) :25. (1'2)68%&2175$&725/,67 )RUVWUHHWRUKLJKZD\FRQVWUXFWLRQWKLVUHTXLUHPHQWDSSOLHVWRDQ\VXEFRQWUDFWRIRUPRUH 1. BIDDER’S NAME: 2. IS THIS A JOINT VENTURE? Yes, No; If “Yes,” list name of each joint venture partner: 3. FEDERAL ID NO.: 4. SF BUSINESS TAX REG. NO.: 5. NAME OF RESPONSIBLE MANAGEMENT OFFICER: 6. DID BIDDER INSPECT THE PROJECT SITE? Yes, No; If “Yes,” list name and phone of person who did the inspection: 7. NAME: 8. PHONE NO: 9. NUMBER OF YEARS BIDDER’S ORGANIZATION HAS HAD EXPERIENCE IN WORK COMPARABLE WITH THAT REQUIRED UNDER THE PROPOSED CONTRACT: _____ Years as a General Contractor _____ Years as a Subcontractor 10. RECENT WORK SIMILAR IN CHARACTER TO THAT REQUIRED IN THE PROPOSED CONTRACT, WHICH BIDDER HAS COMPLETED IN THE PAST 10 YEARS: (a) PROJECT TITLE: PROJECT DESCRIPTION / SCOPE OF WORK: LOCATION: Address, City, State START DATE: PLANNED COMPLETION DATE: ACTUAL COMPLETION DATE: CONTRACT AMOUNT: $ CHANGE ORDER AMOUNT: $ ROLE (Check One): IF GENERAL CONTRACTOR, LIST NAMES OF MAJOR SUBCONTRACTORS EMPLOYED: General Contractor Subcontractor NAME OF OWNER’S REPRESENTATIVE: TITLE: TELEPHONE: BUSINESS ADDRESS: R&S Construction Management Inc. 8 Matt Ramirez 661-863-8782 R&S Construction Management Inc Qualification Statement / References 46-4676160 0486644 Matt Ramirez 8 R&S Construction Management, Inc. License: 992019 1555 Burke Ave, Suite I, San Francisco, CA 94124 Office: 415-746-9564, Fax: 415-534-6692 Email: teera@rscminc.com - 07/2019 FY 2019 Street Resurfacing Project - Palo Alto 2,663,698 Tyler Botkin Associate Engineer tyler.botkin@cityofpaloalto.org 240,000 Various locations, Palo Alto 02/2020 02/2020 250 Hamilton Avenue, Palo Alto, CA 94301 Bulb out, curb ramp construction, curb/gutter, sidewalk, parking strip, st base, pavement renovation, asphalt paving, minor sewer replacement, crack sealing, traffic striping, tree work, traffic routing and associated work Roadway Construction CMC Traffic Control Specialist Graham Contractor Professional Tree Care (b) PROJECT TITLE: PROJECT DESCRIPTION / SCOPE OF WORK: LOCATION: Address, City, State START DATE: PLANNED COMPLETION DATE: ACTUAL COMPLETION DATE: CONTRACT AMOUNT: $ CHANGE ORDER AMOUNT: $ ROLE (Check One): IF GENERAL CONTRACTOR, LIST NAMES OF MAJOR SUBCONTRACTORS EMPLOYED: General Contractor Subcontractor NAME OF OWNER’S REPRESENTATIVE: TITLE: TELEPHONE: BUSINESS ADDRESS: (c) PROJECT TITLE: PROJECT DESCRIPTION / SCOPE OF WORK: LOCATION: Address, City, State START DATE: PLANNED COMPLETION DATE: ACTUAL COMPLETION DATE: CONTRACT AMOUNT: $ CHANGE ORDER AMOUNT: $ ROLE (Check One): IF GENERAL CONTRACTOR, LIST NAMES OF MAJOR SUBCONTRACTORS EMPLOYED: General Contractor Subcontractor NAME OF OWNER’S REPRESENTATIVE: TITLE: TELEPHONE: BUSINESS ADDRESS: R&S Construction Management Inc Qualification Statement / References R&S Construction Management, Inc. License: 992019 1555 Burke Ave, Suite I, San Francisco, CA 94124 Office: 415-746-9564, Fax: 415-534-6692 Email: teera@rscminc.com - 08/2020 1000013347 Various Locations Pavement Renovation and Sewer Replacement No.43 Curb ramp construction, Curb/Gutter, Sidewalk, Parking Strip, St Base, pavement Renovation, bus pad construction, asphalt paving, traffic routing and associated work 615,277 Daniel Brugmann Project Inspector Daniel.Brugmann@sfdpw.org 30 Van Ness Ave, San Francisco, CA - Various locations, San Francisco 03/2021 03/2021 - 08/2020 1000011945 John Yehall Chin School Safe Routes to School 2,783,443 Ricardo Trejo RE ricardo.trejo@sfdpw.org 30 Van Ness Ave, San Francisco, CA - Various locations, San Francisco 10/2022 10/2022 Bulb out, curb ramp construction, curb/gutter, sidewalk, parking strip, st base, pavement renovation, bus pad construction, asphalt paving, sewer replacement, electrical, traffic signal, landscape and irrigation work, traffic routing and associated work JDB & Sons Construction Phoenix Electric CPM Environment CMC Traffic Control Specialist Apex Testing Bayline Cutting and Coring Structural modification at basement: metal deck, concrete, rebar, carpentry, plumbing, electrical (b) PROJECT TITLE: PROJECT DESCRIPTION / SCOPE OF WORK: LOCATION: Address, City, State START DATE: PLANNED COMPLETION DATE: ACTUAL COMPLETION DATE: CONTRACT AMOUNT: $ CHANGE ORDER AMOUNT: $ ROLE (Check One): IF GENERAL CONTRACTOR, LIST NAMES OF MAJOR SUBCONTRACTORS EMPLOYED: General Contractor Subcontractor NAME OF OWNER’S REPRESENTATIVE: TITLE: TELEPHONE: BUSINESS ADDRESS: (c) PROJECT TITLE: PROJECT DESCRIPTION / SCOPE OF WORK: LOCATION: Address, City, State START DATE: PLANNED COMPLETION DATE: ACTUAL COMPLETION DATE: CONTRACT AMOUNT: $ CHANGE ORDER AMOUNT: $ ROLE (Check One): IF GENERAL CONTRACTOR, LIST NAMES OF MAJOR SUBCONTRACTORS EMPLOYED: General Contractor Subcontractor NAME OF OWNER’S REPRESENTATIVE: TITLE: TELEPHONE: BUSINESS ADDRESS: R&S Construction Management Inc Qualification Statement / References R&S Construction Management, Inc. License: 992019 1555 Burke Ave, Suite I, San Francisco, CA 94124 Office: 415-746-9564, Fax: 415-534-6692 Email: teera@rscminc.com WW-628-03 New Headworks Construction - Scope III Southeast Plant misc utility trenches, civil structures, site concrete Place and finish concrete, install waterstop, form slab on grades for the new headworks building. Form, place, finish 750 Phelps St, San Francisco, CA 13,569,381 03/2021 07/2023 ongoing X Jim Wang Construction Manager Construction Manager 525 Golden Gate Ave, 8th Floor, San Francisco, CA 94102 - 01/2022 1000015749 PW Various Locations No. 49 Pavement Renovation_ 1,392,387 Joseph Wong RE joseph.y.wong@sfdpw.org 30 Van Ness Ave, San Francisco, CA - Various locations, San Francisco 02/2023 02/2023 Curb ramp construction, curb/gutter, sidewalk, parking strip, st base, pavement renovation, asphalt paving, traffic routing and associated work QA Constructors CMC Traffic Control Specialist Apex Testing (b) PROJECT TITLE: PROJECT DESCRIPTION / SCOPE OF WORK: LOCATION: Address, City, State START DATE: PLANNED COMPLETION DATE: ACTUAL COMPLETION DATE: CONTRACT AMOUNT: $ CHANGE ORDER AMOUNT: $ ROLE (Check One): IF GENERAL CONTRACTOR, LIST NAMES OF MAJOR SUBCONTRACTORS EMPLOYED: General Contractor Subcontractor NAME OF OWNER’S REPRESENTATIVE: TITLE: TELEPHONE: BUSINESS ADDRESS: (c) PROJECT TITLE: PROJECT DESCRIPTION / SCOPE OF WORK: LOCATION: Address, City, State START DATE: PLANNED COMPLETION DATE: ACTUAL COMPLETION DATE: CONTRACT AMOUNT: $ CHANGE ORDER AMOUNT: $ ROLE (Check One): IF GENERAL CONTRACTOR, LIST NAMES OF MAJOR SUBCONTRACTORS EMPLOYED: General Contractor Subcontractor NAME OF OWNER’S REPRESENTATIVE: TITLE: TELEPHONE: BUSINESS ADDRESS: R&S Construction Management Inc Qualification Statement / References R&S Construction Management, Inc. License: 992019 1555 Burke Ave, Suite I, San Francisco, CA 94124 Office: 415-746-9564, Fax: 415-534-6692 Email: teera@rscminc.com - 01/2022 1000015027 PW Various Locations Pavement Renovation and Sewer Replacement No. 51 1,492,445 Deepak Thakur RE deepak.thakur@sfdpw.org 30 Van Ness Ave, San Francisco, CA - Various locations, San Francisco 11/2022 11/2022 Bulb out, curb ramp construction, curb/gutter, sidewalk, parking strip, st base, pavement renovation, asphalt paving, sewer replacement, traffic routing and associated work JDB & Sons Construction Ronan Construction CMC Traffic Control Specialist Apex Testing 0000002282 PW Various Locations Curb Ramps No.10 Curb ramp construction, curb/gutter, sidewalk, parking strip, st base, pavement renovation, asphalt paving, sewer replacement, traffic routing and associated work Robin Park robin.park@sfdpw.org 02/2023 608,829.00 Various locations, San Francisco 49 S Van Ness Ave, San Francisco, CA 02/2023 JDB & Sons Construction CMC Traffic Control Specialist Apex Testing (b) PROJECT TITLE: PROJECT DESCRIPTION / SCOPE OF WORK: LOCATION: Address, City, State START DATE: PLANNED COMPLETION DATE: ACTUAL COMPLETION DATE: CONTRACT AMOUNT: $ CHANGE ORDER AMOUNT: $ ROLE (Check One): IF GENERAL CONTRACTOR, LIST NAMES OF MAJOR SUBCONTRACTORS EMPLOYED: General Contractor Subcontractor NAME OF OWNER’S REPRESENTATIVE: TITLE: TELEPHONE: BUSINESS ADDRESS: (c) PROJECT TITLE: PROJECT DESCRIPTION / SCOPE OF WORK: LOCATION: Address, City, State START DATE: PLANNED COMPLETION DATE: ACTUAL COMPLETION DATE: CONTRACT AMOUNT: $ CHANGE ORDER AMOUNT: $ ROLE (Check One): IF GENERAL CONTRACTOR, LIST NAMES OF MAJOR SUBCONTRACTORS EMPLOYED: General Contractor Subcontractor NAME OF OWNER’S REPRESENTATIVE: TITLE: TELEPHONE: BUSINESS ADDRESS: R&S Construction Management Inc Qualification Statement / References R&S Construction Management, Inc. License: 992019 1555 Burke Ave, Suite I, San Francisco, CA 94124 Office: 415-746-9564, Fax: 415-534-6692 Email: teera@rscminc.com 05/2021 WD-2739 Pavement Renovation, Sewer Replacement and Water Main Replacement on Castro St and 26th St Curb ramp construction, Curb/Gutter, Sidewalk, Parking Strip, St Base, concrete street pavement, pavement renovation, bus pad construction, asphalt paving, traffic routing and associated work 2,204,561 Brian Wong RE brianp.wong@sfdpw.org - Various locations, San Francisco 12/2021 12/2021 525 Golden Gate Ave, 8th Floor, San Francisco, CA 94102 606,250 Resident Engineer 11/2019 Bulb out, curb ramp construction, curb/gutter, sidewalk, parking strip, st base, pavement renovation, bus pad construction, asphalt paving, sewer replacement, electrical and landscape work, traffic routing and associated work Various Location Curb Ramps No.9 Ben Leung ben.leung@sfdpw.org X 03/2020 02/2020 - Various locations, SF 30 Van Ness Ave, San Francisco, CA Bayline Cutting and Coring JDB & Sons Construction CMC Traffic Control Specialist (b) PROJECT TITLE: PROJECT DESCRIPTION / SCOPE OF WORK: LOCATION: Address, City, State START DATE: PLANNED COMPLETION DATE: ACTUAL COMPLETION DATE: CONTRACT AMOUNT: $ CHANGE ORDER AMOUNT: $ ROLE (Check One): IF GENERAL CONTRACTOR, LIST NAMES OF MAJOR SUBCONTRACTORS EMPLOYED: General Contractor Subcontractor NAME OF OWNER’S REPRESENTATIVE: TITLE: TELEPHONE: BUSINESS ADDRESS: (c) PROJECT TITLE: PROJECT DESCRIPTION / SCOPE OF WORK: LOCATION: Address, City, State START DATE: PLANNED COMPLETION DATE: ACTUAL COMPLETION DATE: CONTRACT AMOUNT: $ CHANGE ORDER AMOUNT: $ ROLE (Check One): IF GENERAL CONTRACTOR, LIST NAMES OF MAJOR SUBCONTRACTORS EMPLOYED: General Contractor Subcontractor NAME OF OWNER’S REPRESENTATIVE: TITLE: TELEPHONE: BUSINESS ADDRESS: R&S Construction Management Inc Qualification Statement / References R&S Construction Management, Inc. License: 992019 1555 Burke Ave, Suite I, San Francisco, CA 94124 Office: 415-746-9564, Fax: 415-534-6692 Email: teera@rscminc.com 4,800,000 Resident Engineer 07/2018 Structural concrete, foundations, equipment pads, walls, site concrete. SF Westside Recycled Water Treatment Facility at Oceanside Plant Thomas Jang tjang@sfwater.org X 12/2020 12/2020 - Oceanside Water Pollution Control Plant - 3500 Great Highway, SF 525 Goldengate Ave, San Francisco, CA 09/2016 2776J As-Needed Curb Ramp Construction No.5 1,471,912 30 Van Ness Ave, San Francisco, CA 181,366 Various Locations, San Francisco 09/2019 09/2019 Trinet Construction Bayline Cutting and Coring Roberto Diaz Rivas RE 415-919-8073 JDB & Sons Construction CMC Traffic Control Specialist Bulb out, curb ramp construction, curb/gutter, sidewalk, parking strip, st base, pavement renovation, bus pad construction, asphalt paving, sewer replacement, electrical, traffic signal, landscape and irrigation work, traffic routing and associated work (b) PROJECT TITLE: PROJECT DESCRIPTION / SCOPE OF WORK: LOCATION: Address, City, State START DATE: PLANNED COMPLETION DATE: ACTUAL COMPLETION DATE: CONTRACT AMOUNT: $ CHANGE ORDER AMOUNT: $ ROLE (Check One): IF GENERAL CONTRACTOR, LIST NAMES OF MAJOR SUBCONTRACTORS EMPLOYED: General Contractor Subcontractor NAME OF OWNER’S REPRESENTATIVE: TITLE: TELEPHONE: BUSINESS ADDRESS: (c) PROJECT TITLE: PROJECT DESCRIPTION / SCOPE OF WORK: LOCATION: Address, City, State START DATE: PLANNED COMPLETION DATE: ACTUAL COMPLETION DATE: CONTRACT AMOUNT: $ CHANGE ORDER AMOUNT: $ ROLE (Check One): IF GENERAL CONTRACTOR, LIST NAMES OF MAJOR SUBCONTRACTORS EMPLOYED: General Contractor Subcontractor NAME OF OWNER’S REPRESENTATIVE: TITLE: TELEPHONE: BUSINESS ADDRESS: R&S Construction Management Inc Qualification Statement / References R&S Construction Management, Inc. License: 992019 1555 Burke Ave, Suite I, San Francisco, CA 94124 Office: 415-746-9564, Fax: 415-534-6692 Email: teera@rscminc.com 1,298,706 Roberto Diaz Rivas Resident Engineer 415-919-8073 Various Locations, San Francisco, CA 65,654 9/2017 05/2018 05/2018 2657J Octavia Blvd and Oak St Enhancement Project Bulb out, curb ramp construction, curb/gutter, sidewalk, parking strip, st base, pavement renovation, bus pad construction, asphalt paving, sewer replacement, electrical, traffic signal, landscape and irrigation work, traffic routing and associated work 30 Van Ness Ave, San Francisco, CA JDB & Sons Construction Phoenix Electric P&J Utility CMC Traffic Control Specialist Neary Landscape JOC-77 General Engineering San Francisco, San Mateo, Santa Clara, and Alameda Counties 11/2018 11/2022 Big Valley Electric; Bailey Fence Company Inc; Blocka Construction Inc; Bay Tech Engineering, Inc Jennifer Walker Project Manager 525 Golden Gate Ave, 8th Floor, San Francisco, CA 94102 2,750,000 750,000 JenWalker@sfwater.org G4S Secure Integration LLC; Monticelli Painting and Decorating; Phoenix Electric Company Various locations, San Francisco, San Mateo, Santa Clara, and Alameda Counties Misc General Engineering work - demolition, excavation, concrete, asphalt, pipeline, electrical, plumbing, fencing, security system and integration, painting, etc. 11/2022 (b) PROJECT TITLE: PROJECT DESCRIPTION / SCOPE OF WORK: LOCATION: Address, City, State START DATE: PLANNED COMPLETION DATE: ACTUAL COMPLETION DATE: CONTRACT AMOUNT: $ CHANGE ORDER AMOUNT: $ ROLE (Check One): IF GENERAL CONTRACTOR, LIST NAMES OF MAJOR SUBCONTRACTORS EMPLOYED: General Contractor Subcontractor NAME OF OWNER’S REPRESENTATIVE: TITLE: TELEPHONE: BUSINESS ADDRESS: (c) PROJECT TITLE: PROJECT DESCRIPTION / SCOPE OF WORK: LOCATION: Address, City, State START DATE: PLANNED COMPLETION DATE: ACTUAL COMPLETION DATE: CONTRACT AMOUNT: $ CHANGE ORDER AMOUNT: $ ROLE (Check One): IF GENERAL CONTRACTOR, LIST NAMES OF MAJOR SUBCONTRACTORS EMPLOYED: General Contractor Subcontractor NAME OF OWNER’S REPRESENTATIVE: TITLE: TELEPHONE: BUSINESS ADDRESS: R&S Construction Management Inc Qualification Statement / References R&S Construction Management, Inc. License: 992019 1555 Burke Ave, Suite I, San Francisco, CA 94124 Office: 415-746-9564, Fax: 415-534-6692 Email: teera@rscminc.com - 04/2021 WW-662R SEWPCP Power Feed and Primary Switchgear Upgrades 1,120,837 - SFPUC Southeast Treatment Plant, 750 Phelps St, San Francisco, CA 94124 12/2021 12/2021 - 01/2021 WW-687 Force Main Rehabilitation at Embarcadero and Jackson 447,167 Jeff Young RE - Embarcadero and Washington St, San Francisco 08/2021 08/2021 525 Golden Gate Ave, 8th Floor, San Francisco, CA 94102 Resident Engineer Structural concrete, foundations, equipment pads, walls, site concrete. Structural concrete, foundations, equipment pads, walls, roof, falsework shoring, site concrete. 525 Golden Gate Ave, 8th Floor, San Francisco, CA 94102 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 29 General Conditions Article 1 - Definitions Definitions. The following definitions apply to all of the Contract Documents unless otherwise indicated, e.g., additional definitions that apply solely to the Specifications or other technical documents. Defined terms and titles of documents are capitalized in the Contract Documents, with the exception of the following (in any tense or form): “day,” “furnish,” “including,” “install,” “work day” or “working day.” Allowance means a specific amount that must be included in the Bid Proposal for a specified purpose. Article, as used in these General Conditions, means a numbered Article of the General Conditions, unless otherwise indicated by the context. Change Order means a written document duly approved and executed by City, which changes the scope of Work, the Contract Price, or the Contract Time. City means the municipality which has entered into the Contract with Contractor for performance of the Work, acting through its City Council, officers, employees, City Engineer, and any other authorized representatives. City Engineer means the City Engineer for City and his or her authorized delegee(s). Claim means a separate demand by Contractor for a change in the Contract Time or Contract Price, that has previously been submitted to City in accordance with the requirements of the Contract Documents, and which has been rejected by City, in whole or in part; or a written demand by Contractor objecting to the amount of Final Payment. Contract means the signed agreement between City and Contractor for performing the Work required for the Project, and all documents expressly incorporated therein. Contract Documents means, collectively, all of the documents listed as such in Section 2 of the Contract, including the Notice Inviting Bids; the Instructions to Bidders; addenda, if any; the Bid Proposal, and attachments thereto; the Contract; the Notice of Potential Award and Notice to Proceed; the payment and performance bonds; the General Conditions; the Special Conditions; the Project Plans and Specifications; any Change Orders; and any other documents which are clearly and unambiguously made part of the Contract Documents. The Contract Documents do not include documents provided “For Reference Only,” or documents that are intended solely to provide information regarding existing conditions. Contract Price means the total compensation to be paid to Contractor for performance of the Work, as set forth in the Contract and as may be amended by Change Order or adjusted for an Allowance. The Contract Price is not subject to adjustment due to inflation or due to the increased cost of labor, material, supplies or equipment following submission of the Bid Proposal. Contract Time means the time specified for complete performance of the Work, as set forth in the Contract and as may be amended by Change Order. Contractor means the individual, partnership, corporation, or joint-venture that has signed the Contract with City to perform the Work. Day means a calendar day unless otherwise specified. 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 30 Design Professional means the licensed individual(s) or firm(s) retained by City to provide architectural, engineering, or electrical engineering design services for the Project. If no Design Professional has been retained for this Project, any reference to Design Professional is deemed to refer to the Engineer. DIR means the California Department of Industrial Relations. Drawings has the same meaning as Plans. Engineer means the City Engineer for the City of Cupertino and his or her authorized delegees. Excusable Delay is defined in Section 5.3(B), Excusable Delay. Extra Work means new or unforeseen work added to the Project, as determined by the Engineer in his or her sole discretion, including Work that was not part of or incidental to the scope of the Work when the Contractor’s bid was submitted; Work that is substantially different from the Work as described in the Contract Documents at bid time; or Work that results from a substantially differing and unforeseeable condition. Final Completion means Contractor has fully completed all of the Work required by the Contract Documents to the City’s satisfaction, including all punch list items and any required commissioning or training, and has provided the City with all required submittals, including the instructions and manuals, product warranties, and as-built drawings. Final Payment means payment to Contractor of the unpaid Contract Price, including release of undisputed retention, less amounts withheld or deducted pursuant to the Contract Documents. Furnish means to purchase and deliver for the Project. Government Code Claim means a claim submitted pursuant to California Government Code § 900 et seq. Hazardous Materials means any substance or material identified now or in the future as hazardous under any Laws, or any other substance or material that may be considered hazardous or otherwise subject to Laws governing handling, disposal, or cleanup. Including, whether or not capitalized, means “including, but not limited to,” unless the context clearly requires otherwise. Inspector means the individual(s) or firm(s) retained or employed by City to inspect the workmanship, materials, and manner of construction of the Project and its components to ensure compliance with the Contract Documents and all Laws. Install means to fix in place for materials, and to fix in place and connect for equipment. Laws means all applicable local, state, and federal laws, regulations, rules, codes, ordinances, permits, orders, and the like enacted or imposed by or under the auspices of any governmental entity with jurisdiction over any of the Work or any performance of the Work, including health and safety requirements. Non-Excusable Delay is defined in Section 5.3(D), Non-Excusable Delay. Plans means the City-provided plans, drawings, details, or graphical depictions of the Project requirements, but does not include Shop Drawings. Project means the public works project referenced in the Contract. 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 31 Project Manager means the individual designated by City to oversee and manage the Project on City’s behalf and may include his or her authorized delegee(s) when the Project Manager is unavailable. If no Project Manager has been designated for this Project, any reference to Project Manager is deemed to refer to the Engineer. Recoverable Costs is defined in Section 5.3(F), Recoverable Costs. Request for Information or RFI means Contractor’s written request for information about the Contract Documents, the Work or the Project, submitted to City in the manner and format specified by City. Section, when capitalized in these General Conditions, means a numbered section or subsection of the General Conditions, unless the context clearly indicates otherwise. Shop Drawings means drawings, plan details or other graphical depictions prepared by or on behalf of Contractor, and subject to City acceptance, which are intended to provide details for fabrication, installation, and the like, of items required by or shown in the Plans or Specifications. Specialty Work means Work that must be performed by a specialized Subcontractor with the specified license or other special certification, and that the Contractor is not qualified to self- perform. Specifications means the technical, text specifications describing the Project requirements, which are prepared for and incorporated into the Contract by or on behalf of City, and does not include the Contract, General Conditions or Special Conditions. Subcontractor means an individual, partnership, corporation, or joint-venture retained by Contractor directly or indirectly through a subcontract to perform a specific portion of the Work. The term Subcontractor applies to subcontractors of all tiers, unless otherwise indicated by the context. A third party such as a utility performing related work on the Project is not a Subcontractor, even if Contractor must coordinate its Work with the third party. Technical Specifications has the same meaning as Specifications. Work means all of the construction and services necessary for or incidental to completing the Project in conformance with the requirements of the Contract Documents. Work Day or Working Day, whether or not capitalized, means a weekday when the City is open for business, and does not include holidays observed by the City. Holidays observed by the City and furlough days are: a. New Year’s Day, January 1; b. Martin Luther King Jr.’s Birthday, third Monday in January; c. Lincoln’s Birthday, February 12; d. Presidents’ Day, third Monday in February; e. Memorial Day, last Monday in May; f. Independence Day, July 4; g. Labor Day, first Monday in September; h. Veterans’ Day, November 11; i. Thanksgiving Day, as designated by the President; j. The Day following Thanksgiving Day; 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 32 k. Christmas Day, December 25; l. City Closure, December 24, 26, 27,28,29,30 and 31: and m. Each day appointed by the Governor of California and formally recognized by the Santa Clara County Board of Supervisors as a day of mourning, thanksgiving, or special observance. Worksite means the place or places where the Work is performed, which includes, but may extend beyond the Project site, including separate locations for staging, storage, or fabrication. Article 2 - Roles and Responsibilities 2.1 City. (A) City Council. The City Council has final authority in all matters affecting the Project, except to the extent it has delegated authority to the Engineer. (B) Engineer. The Engineer, acting within the authority conferred by the City Council, is responsible for administration of the Project on behalf of City, including authority to provide directions to the Design Professional and to Contractor to ensure proper and timely completion of the Project. The Engineer’s decisions are final and conclusive within the scope of his or her authority, including interpretation of the Contract Documents. (C) Project Manager. The Project Manager assigned to the Project will be the primary point of contact for the Contractor and will serve as City’s representative for daily administration of the Project on behalf of City. Unless otherwise specified, all of Contractor’s communications to City (in any form) will go to or through the Project Manager. City reserves the right to reassign the Project Manager role at any time or to delegate duties to additional City representatives, without prior notice to or consent of Contractor. (D) Design Professional. The Design Professional is responsible for the overall design of the Project and, to the extent authorized by City, may act on City’s behalf to ensure performance of the Work in compliance with the Plans and Specifications, including any design changes authorized by Change Order. The Design Professional’s duties may include review of Contractor’s submittals, visits to any Worksite, inspecting the Work, evaluating test and inspection results, and participation in Project-related meetings, including any pre-construction conference, weekly meetings, and coordination meetings. The Design Professional’s interpretation of the Plans or Specifications is final and conclusive. 2.2 Contractor. (A) General. Contractor must provide all labor, materials, supplies, equipment, services, and incidentals necessary to perform and timely complete the Work in strict accordance with the Contract Documents, and in an economical and efficient manner in the best interests of City, and with minimal inconvenience to the public. (B) Responsibility for the Work and Risk of Loss. Contractor is responsible for supervising and directing all aspects of the Work to facilitate the efficient and timely completion of the Work. Contractor is solely responsible for and required to exercise full control over the Work, including the construction means, methods, techniques, sequences, procedures, safety precautions and programs, and coordination of all portions of the Work with that of all other contractors and Subcontractors, except to the 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 33 extent that the Contract Documents provide other specific instructions. Contractor’s responsibilities extend to any plan, method or sequence suggested, but not required by City or specified in the Contract Documents. From the date of commencement of the Work until either the date on which City formally accepts the Project or the effective date of termination of the Contract, whichever is later, Contractor bears all risks of injury or damage to the Work and the materials and equipment delivered to any Worksite, by any cause including fire, earthquake, wind, weather, vandalism or theft. (C) Project Administration. Contractor must provide sufficient and competent administration, staff, and skilled workforce necessary to perform and timely complete the Work in accordance with the Contract Documents. Before starting the Work, Contractor must designate in writing and provide complete contact information, including telephone numbers and email address, for the officer or employee in Contractor’s organization who is to serve as Contractor’s primary representative for the Project, and who has authority to act on Contractor’s behalf. A Subcontractor may not serve as Contractor’s primary representative. (D) On-Site Superintendent. Contractor must, at all times during performance of the Work, provide a qualified and competent full-time superintendent acceptable to City, and assistants as necessary, who must be physically present at the Project site while any aspect of the Work is being performed. The superintendent must have full authority to act and communicate on behalf of Contractor, and Contractor will be bound by the superintendent’s communications to City. City’s approval of the superintendent is required before the Work commences. If City is not satisfied with the superintendent’s performance, City may request a qualified replacement of the superintendent. Failure to comply may result in temporary suspension of the Work, at Contractor’s sole expense and with no extension of Contract Time, until an approved superintendent is physically present to supervise the Work. Contractor must provide written notice to City, as soon as practicable, before replacing the superintendent. (E) Standards. Contractor must, at all times, ensure that the Work is performed in an efficient, skillful manner following best practices and in full compliance with the Contract Documents and Laws and applicable manufacturer’s recommendations. Contractor has a material and ongoing obligation to provide true and complete information, to the best of its knowledge, with respect to all records, documents, or communications pertaining to the Project, including oral or written reports, statements, certifications, Change Order requests, or Claims. (F) Meetings. Contractor, its project manager, superintendent and any primary Subcontractors requested by City, must attend a pre-construction conference, if requested by City, as well as weekly Project progress meetings scheduled with City. If applicable, Contractor may also be required to participate in coordination meetings with other parties relating to other work being performed on or near the Project site or in relation to the Project, including work or activities performed by City, other contractors, or other utility owners. (G) Construction Records. Contractor will maintain up-to-date, thorough, legible, and dated daily job reports, which document all significant activity on the Project for each day that Work is performed on the Project. The daily report for each day must include the number of workers at the Project site; primary Work activities; major deliveries; problems encountered, including injuries, if any; weather and site conditions; and delays, if any. Contractor will take date and time-stamped photographs to document general progress of the Project, including site conditions prior to construction activities, before and after photographs at offset trench laterals, existing improvements and utilities, damage and restoration. Contractor will maintain copies of all subcontracts, Project-related correspondence with subcontractors, and records of meetings with Subcontractors. Upon 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 34 request by the City, Contractor will permit review of and/or provide copies of any of these construction records. (H) Responsible Party. Contractor is solely responsible to City for the acts or omissions of any Subcontractors, or any other party or parties performing portions of the Work or providing equipment, materials or services for or on behalf of Contractor or the Subcontractors. Upon City’s written request, Contractor must promptly and permanently remove from the Project, at no cost to City, any employee or Subcontractor or employee of a Subcontractor who the Engineer has determined to be incompetent, intemperate or disorderly, or who has failed or refused to perform the Work as required under the Contract Documents. (I) Correction of Defects. Contractor must promptly correct, at Contractor’s sole expense, any Work that is determined by City to be deficient or defective in any way, including workmanship, materials, parts or equipment. Workmanship, materials, parts or equipment that do not conform to the requirements under the Plans, Specifications and every other Contract Document, as determined by City, will be considered defective and subject to rejection. Contractor must also promptly correct, at Contractor’s sole expense, any Work performed beyond the lines and grades shown on the Plans or established by City, and any Extra Work performed without City’s prior written approval. If Contractor fails to correct or to take reasonable steps toward correcting defective Work within five days following notice from City, or within the time specified in City’s notice to correct, City may elect to have the defective Work corrected by its own forces or by a third party, in which case the cost of correction will be deducted from the Contract Price. If City elects to correct defective Work due to Contractor’s failure or refusal to do so, City or its agents will have the right to take possession of and use any equipment, supplies, or materials available at the Project site or any Worksite on City property, in order to effectuate the correction, at no extra cost to City. Contractor’s warranty obligations under Section 11.2, Warranty, will not be waived nor limited by City’s actions to correct defective Work under these circumstances. Alternatively, City may elect to retain defective Work, and deduct the difference in value, as determined by the Engineer, from payments otherwise due to Contractor. This paragraph applies to any defective Work performed by Contractor during the one-year warranty period under Section 11.2. (J) Contractor’s Records. Contractor must maintain all of its records relating to the Project in any form, including paper documents, photos, videos, electronic records, approved samples, and the construction records required pursuant to paragraph (G), above. Project records subject to this provision include complete Project cost records and records relating to preparation of Contractor’s bid, including estimates, take-offs, and price quotes or bids. (1) Contractor’s cost records must include all supporting documentation, including original receipts, invoices, and payroll records, evidencing its direct costs to perform the Work, including, but not limited to, costs for labor, materials and equipment. Each cost record should include, at a minimum, a description of the expenditure with references to the applicable requirements of the Contract Documents, the amount actually paid, the date of payment, and whether the expenditure is part of the original Contract Price, related to an executed Change Order, or otherwise categorized by Contractor as Extra Work. Contractor’s failure to comply with this provision as to any claimed cost operates as a waiver of any rights to recover the claimed cost. (2) Contractor must continue to maintain its Project-related records in an organized manner for a period of five years after City’s acceptance of the Project or following Contract termination, whichever occurs first. Subject to prior notice to Contractor, City is entitled to inspect or audit any of Contractor’s Project records 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 35 relating to the Project or to investigate Contractor’s plant or equipment during Contractor’s normal business hours. The record-keeping requirements set forth in this subsection 2.2(J) will survive expiration or termination of the Contract. (K) Copies of Project Documents. Contractor and its Subcontractors must keep copies, at the Project site, of all Work-related documents, including the Contract, permit(s), Plans, Specifications, Addenda, Contract amendments, Change Orders, RFIs and RFI responses, Shop Drawings, as-built drawings, schedules, daily records, testing and inspection reports or results, and any related written interpretations. These documents must be available to City for reference at all times during construction of the Project. 2.3 Subcontractors. (A) General. All Work which is not performed by Contractor with its own forces must be performed by Subcontractors. City reserves the right to approve or reject any and all Subcontractors proposed to perform the Work, for reasons including the subcontractor’s poor reputation, lack of relevant experience, financial instability, and lack of technical ability or adequate trained workforce. Each Subcontractor must obtain a City business license before performing any Work. (B) Contractual Obligations. Contractor must require each Subcontractor to comply with the provisions of the Contract Documents as they apply to the Subcontractor’s portion(s) of the Work, including the generally applicable terms of the Contract Documents, and to likewise bind their subcontractors. Contractor will provide that the rights that each Subcontractor may have against any manufacturer or supplier for breach of warranty or guarantee relating to items provided by the Subcontractor for the Project, will be assigned to City. Nothing in these Contract Documents creates a contractual relationship between a Subcontractor and City, but City is deemed to be a third-party beneficiary of the contract between Contractor and each Subcontractor. (C) Termination. If the Contract is terminated, each Subcontractor’s agreement must be assigned by Contractor to City, subject to the prior rights of any surety, but only if and to the extent that City accepts, in writing, the assignment by written notification, and assumes all rights and obligations of Contractor pursuant to each such subcontract agreement. (D) Substitution of Subcontractor. If Contractor requests substitution of a listed Subcontractor under Public Contract Code § 4107, Contractor is solely responsible for all costs City incurs in responding to the request, including legal fees and costs to conduct a hearing, and any increased subcontract cost to perform the Work that was to be performed by the listed Subcontractor. If City determines that a Subcontractor is unacceptable to City based on the Subcontractor’s failure to satisfactorily perform its Work, or for any of the grounds for substitution listed in Public Contract Code § 4107(a), City may request removal of the Subcontractor from the Project. Upon receipt of a written request from City to remove a Subcontractor pursuant to this paragraph, Contractor will immediately remove the Subcontractor from the Project and, at no further cost to City, will either (1) self-perform the remaining Work to the extent that Contractor is duly licensed and qualified to do so, or (2) substitute a Subcontractor that is acceptable to City, in compliance with Public Contract Code § 4107, as applicable. 2.4 Coordination of Work. (A) Concurrent Work. City reserves the right to perform, have performed, or permit performance of other work on or adjacent to the Project site while the Work is being performed for the Project. Contractor is responsible for coordinating its Work with other 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 36 work being performed on or adjacent to the Project site, including by any utility companies or agencies, and must avoid hindering, delaying, or interfering with the work of other contractors, individuals, or entities, and must ensure safe and reasonable site access and use as required or authorized by City. To the full extent permitted by law, Contractor must hold harmless and indemnify City against any and all claims arising from or related to Contractor’s avoidable, negligent, or willful hindrance of, delay to, or interference with the work of any utility company or agency or another contractor or subcontractor. (B) Coordination. If Contractor’s Work will connect or interface with work performed by others, Contractor is responsible for independently measuring and visually inspecting such work to ensure a correct connection and interface. Contractor is responsible for any failure by Contractor or its Subcontractors to confirm measurements before proceeding with connecting Work. Before proceeding with any portion of the Work affected by the construction or operations of others, Contractor must give the Project Manager prompt written notification of any defects Contractor discovers which will prevent the proper execution of the Work. Failure to give notice of any known or reasonably discoverable defects will be deemed acknowledgement by Contractor that the work of others is not defective and will not prevent the proper execution of the Work. Contractor must also promptly notify City if work performed by others, including work or activities performed by City’s own forces, is operating to hinder, delay, or interfere with Contractor’s timely performance of the Work. City reserves the right to backcharge Contractor for any additional costs incurred due to Contractor’s failure to comply with the requirements in this Section 2.4. 2.5 Submittals. Unless otherwise specified, Contractor must submit to the Engineer for review and acceptance, all schedules, Shop Drawings, samples, product data, and similar submittals required by the Contract Documents, or upon request by the Engineer. Unless otherwise specified, all submittals, including Requests for Information, are subject to the general provisions of this Section, as well as specific submittal requirements that may be included elsewhere in the Contract Documents, including the Special Conditions or Specifications. The Engineer may require submission of a submittal schedule at or before a pre-construction conference, as may be specified in the Notice to Proceed. (A) General. Contractor is responsible for ensuring that its submittals are accurate and conform to the Contract Documents. (B) Time and Manner of Submission. Contractor must ensure that its submittals are prepared and delivered in a manner consistent with the current City-accepted schedule for the Work and within the applicable time specified in the Contract Documents, or if no time is specified, in such time and sequence so as not to delay the performance of the Work or completion of the Project. (C) Required Contents. Each submittal must include the Project name and contract number, Contractor’s name and address, the name and address of any Subcontractor or supplier involved with the submittal, the date, and references to applicable Specification section(s) and/or drawing and detail number(s). (D) Required Corrections. If corrections are required, Contractor must promptly make and submit any required corrections as specified in full conformance with the requirements of this Section, or other requirements that apply to that submittal. (E) Effect of Review and Acceptance. Review and acceptance of a submittal by City will not relieve Contractor from complying with the requirements of the Contract Documents. Contractor is responsible for any errors in any submittal, and review or acceptance of a submittal by City is not an assumption of risk or liability by City. 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 37 (F) Enforcement. Any Work performed or any material furnished, installed, fabricated or used without City’s prior acceptance of a required submittal is performed or provided at Contractor’s risk, and Contractor may be required to bear the costs incident thereto, including the cost of removing and replacing such Work, repairs to other affected portions of the Work or material, and the cost of additional time or services required of City, including costs for the Design Professional, Project Manager, or Inspector. (G) Excessive RFIs. A RFI will be considered excessive or unnecessary if City determines that the explanation or response to the RFI is clearly and unambiguously discernable from the Contract Documents. City’s costs to review and respond to excessive or unnecessary RFIs may be deducted from payments otherwise due to Contractor. 2.6 Shop Drawings. When Shop Drawings are required by the Specifications or requested by the Engineer, they must be prepared according to best practices at Contractor’s expense. The Shop Drawings must be of a size and scale to clearly show all necessary details. Unless otherwise specified by City, Shop Drawings must be provided to the Engineer for review and acceptance at least 30 days before the Work will be performed. If City requires changes, the corrected Shop Drawings must be resubmitted to the Engineer for review within the time specified by the Engineer. For all Project components requiring Shop Drawings, Contractor will not furnish materials or perform any Work until the Shop Drawings for those components are accepted by City. Contractor is responsible for any errors or omissions in the Shop Drawings, shop fits and field corrections; any deviations from the Contract Documents; and for the results obtained by the use of Shop Drawings. Acceptance of Shop Drawings by City does not relieve Contractor of Contractor’s responsibility. 2.7 Access to Work. Contractor must afford prompt and safe access to any Worksite by City and its employees, agents, or consultants authorized by City; and upon request by City, Contractor must promptly arrange for City representatives to visit or inspect manufacturing sites or fabrication facilities for items to be incorporated into the Work. 2.8 Personnel. Contractor and its Subcontractors must employ only competent and skillful personnel to perform the Work. Contractor and its Subcontractor’s supervisors, security or safety personnel, and employees who have unescorted access to the Project site must possess proficiency in English sufficient to read, understand, receive, and implement oral or written communications or instructions relating to their respective job functions, including safety and security requirements. Upon written notification from the Engineer, Contractor and its Subcontractors must immediately discharge any personnel who are incompetent, disorderly, disruptive, threatening, abusive, or profane, or otherwise refuse or fail to comply with the requirements of the Contract Documents or Laws, including Laws pertaining to health and safety. Any such discharged personnel, may not be re- employed or permitted on the Project in any capacity without City’s prior written consent. Article 3 - Contract Documents 3.1 Interpretation of Contract Documents. (A) Plans and Specifications. The Plans and Specifications included in the Contract Documents are complementary. If Work is shown on one but not on the other, Contractor must perform the Work as though fully described on both, consistent with the Contract Documents and reasonably inferable from them as being necessary to produce the indicated results. The Plans and Specifications are deemed to include and require everything necessary and reasonably incidental to completion of the Work, whether or 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 38 not particularly mentioned or shown. Contractor must perform all Work and services and supply all things reasonably related to and inferable from the Contract Documents. In the event of a conflict between the Plans and Specifications, the Specifications will control, unless the drawing(s) at issue are dated later than the Specification(s) at issue. Detailed drawings take precedence over general drawings, and large-scale drawings take precedence over smaller scale drawings. Any arrangement or division of the Plans and Specifications into sections is for convenience and is not intended to limit the Work required by separate trades. A conclusion presented in the Plans or Specifications is only a recommendation. Actual locations and depths must be determined by Contractor’s field investigation. Contractor may request access to underlying or background information in City’s possession that is necessary for Contractor to form its own conclusions. (B) Duty to Notify and Seek Direction. If Contractor becomes aware of a changed condition in the Project, or of any ambiguity, conflict, inconsistency, discrepancy, omission, or error in the Contract Documents, including the Plans or Specifications, Contractor must promptly submit a Request for Information to the Engineer and wait for a response from City before proceeding further with the related Work. The RFI must notify City of the issue and request clarification, interpretation or direction. The Engineer’s clarification, interpretation or direction will be final and binding on Contractor. If Contractor proceeds with the related Work before obtaining City’s response, Contractor will be responsible for any resulting costs, including the cost of correcting any incorrect or defective Work that results. Timely submission of a clear and complete RFI is essential to avoiding delay. Delay resulting from Contractor’s failure to submit a timely and complete RFI to the Engineer is Non-Excusable Delay. If Contractor believes that City’s response to an RFI justifies a change to the Contract Price or Contract Time, Contractor must perform the Work as directed, but may submit a timely Change Order request in accordance with the Contract Documents. (See Article 5 and 6.) (C) Figures and Dimensions. Figures control over scaled dimensions. (D) Technical or Trade Terms. Any terms that have well-known technical or trade meanings will be interpreted in accordance with those meanings, unless otherwise specifically defined in the Contract Documents. (E) Measurements. Contractor must verify all relevant measurements in the Contract Documents and at the Project site before ordering any material or performing any Work, and will be responsible for the correctness of those measurements or for costs that could have been avoided by independently verifying measurements. (F) Compliance with Laws. The Contract Documents are intended to comply with Laws and will be interpreted to comply with Laws. 3.2 Order of Precedence. Information included in one Contract Document but not in another will not be considered a conflict or inconsistency. Unless otherwise specified in the Special Conditions, in case of any conflict or inconsistency among the Contract Documents, the following order of precedence will apply, beginning from highest to lowest, with the most recent version taking precedent over an earlier version: (A) Change Orders; (B) Addenda; (C) Contract; (D) Notice to Proceed; (E) Attachment B – Federal Contract Requirements (only if used); (F) Special Conditions; (G) General Conditions; (H) Payment and Performance Bonds; 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 39 (I) Specifications; (J) Plans; (K) Notice of Potential Award; (L) Notice Inviting Bids; (M) Attachment A – Federal Bidding Requirements (only if used); (N) Instructions to Bidders; (O) Contractor’s Bid Proposal and attachments; (P) the City’s standard specifications, as applicable; and (Q) Any generic documents prepared by and on behalf of a third party, that were not prepared specifically for this Project, such as the Caltrans Standard Specifications or Caltrans Special Provisions. 3.3 Caltrans Standard Specifications. Any reference to or incorporation of the Standard Specifications of the State of California, Department of Transportation (“Caltrans”), including “Standard Specifications,” “Caltrans Specifications,” “State Specifications,” or “CSS,” means the most current edition of Caltrans’ Standard Specifications, unless otherwise specified (“Caltrans Standard Specifications”), including the most current amendments as of the date that Contractor’s bid was submitted for this Project. The following provisions apply to use of or reference to the Caltrans Standard Specifications or Special Provisions: (A) Limitations. The “General Provisions” of the Caltrans Standard Specifications, i.e., sections 1 through 9, do not apply to these Contract Documents with the exception of any specific provisions, if any, which are expressly stated to apply to these Contract Documents. (B) Conflicts or Inconsistencies. If there is a conflict or inconsistency between any provision in the Caltrans Standard Specifications or Special Provisions and a provision of these Contract Documents, as determined by City, the provision in the Contract Documents will govern. (C) Meanings. Terms used in the Caltrans Standard Specifications or Special Provisions are to be interpreted as follows: (1) Any reference to the “Engineer” is deemed to mean the City Engineer. (2) Any reference to the “Special Provisions” is deemed to mean the Special Conditions, unless the Caltrans Special Provisions are expressly included in the Contract Documents listed in Section 2 of the Contract. (3) Any reference to the “Department” or “State” is deemed to mean City. 3.4 For Reference Only. Contractor is responsible for the careful review of any document, study, or report provided by City or appended to the Contract Documents solely for informational purposes and identified as “For Reference Only.” Nothing in any document, study, or report so appended and identified is intended to supplement, alter, or void any provision of the Contract Documents. Contractor is advised that City or its representatives may be guided by information or recommendations included in such reference documents, particularly when making determinations as to the acceptability of proposed materials, methods, or changes in the Work. Any record drawings or similar final or accepted drawings or maps that are not part of the Contract Documents are deemed to be For Reference Only. The provisions of the Contract Documents are not modified by any perceived or actual conflict with provisions in any document that is provided For Reference Only. 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 40 3.5 Current Versions. Unless otherwise specified by City, any reference to standard specifications, technical specifications, or any City or state codes or regulations means the latest specification, code or regulation in effect at the time the Contract is signed. 3.6 Conformed Copies. If City prepares a conformed set of the Contract Documents following award of the Contract, it will provide Contractor with two hard copy (paper) sets and one copy of the electronic file in PDF format. It is Contractor’s responsibility to ensure that all Subcontractors, including fabricators, are provided with the conformed set of the Contract Documents at Contractor’s sole expense. 3.7 Ownership. No portion of the Contract Documents may be used for any purpose other than construction of the Project, without prior written consent from City. Contractor is deemed to have conveyed the copyright in any designs, drawings, specifications, Shop Drawings, or other documents (in paper or electronic form) developed by Contractor for the Project, and City will retain all rights to such works, including the right to possession. Article 4 - Bonds, Indemnity, and Insurance 4.1 Payment and Performance Bonds. Within ten days following issuance of the Notice of Potential Award, Contractor is required to provide a payment bond and a performance bond, each in the penal sum of not less than 100% of the Contract Price, and each executed by Contractor and its surety using the bond forms included with the Contract Documents. (A) Surety. Each bond must be issued and executed by a surety admitted in California. If an issuing surety cancels the bond or becomes insolvent, within seven days following written notice from City, Contractor must substitute a surety acceptable to City. If Contractor fails to substitute an acceptable surety within the specified time, City may, at its sole discretion, withhold payment from Contractor until the surety is replaced to City’s satisfaction, or terminate the Contract for default. (B) Supplemental Bonds for Increase in Contract Price. If the Contract Price increases during construction by five percent or more over the original Contract Price, Contractor must provide supplemental or replacement bonds within ten days of written notice from City pursuant to this Section, covering 100% of the increased Contract Price and using the bond forms included with the Contract Documents. 4.2 Indemnity. To the fullest extent permitted by law, Contractor must indemnify, defend, and hold harmless City, its Council, officers, officials, employees, agents, volunteers, and consultants (individually, an “Indemnitee,” and collectively the “Indemnitees”) from and against any and all liability, loss, damage, claims, causes of action, demands, charges, fines, costs, and expenses (including, without limitation, attorney fees, expert witness fees, paralegal fees, and fees and costs of litigation or arbitration) (collectively, “Liability”) of every nature arising out of or in connection with the acts or omissions of Contractor, its employees, Subcontractors, representatives, or agents, in bidding or performing the Work or in failing to comply with any obligation of Contractor under the Contract, except such Liability caused by the active negligence, sole negligence, or willful misconduct of an Indemnitee. This indemnity requirement applies to any Liability arising from alleged defects in the content or manner of submission of Contractor’s bid for the Contract. Contractor’s failure or refusal to timely accept a tender of defense pursuant to this Contract will be deemed a material breach of the Contract. City will timely notify Contractor upon receipt of any third-party claim relating to the Contract, as required by Public Contract Code § 9201. Contractor waives any right to express or implied indemnity against any Indemnitee. Contractor’s indemnity obligations under this Contract will survive the expiration or any early termination of the Contract. 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 41 4.3 Insurance. No later than ten days following issuance of the Notice of Potential Award, Contractor must procure and provide proof of the insurance coverage required by this Section in the form of certificates and endorsements acceptable to City. The required insurance must cover the activities of Contractor and its Subcontractors relating to or arising from the performance of the Work, and must remain in full force and effect at all times during the period covered by the Contract, through the date of City’s acceptance of the Project. All required insurance must be issued by a company licensed to do business in the State of California, and each such insurer must have an A.M. Best’s financial strength rating of “A” or better and a financial size rating of “VIII” or better. If Contractor fails to provide any of the required coverage in full compliance with the requirements of the Contract Documents, City may, at its sole discretion, purchase such coverage at Contractor’s expense and deduct the cost from payments due to Contractor, or terminate the Contract for default. The procurement of the required insurance will not be construed to limit Contractor’s liability under this Contract or to fulfill Contractor’s indemnification obligations under this Contract. (A) Policies and Limits. The following insurance policies and limits are required for this Contract, unless otherwise specified in the Special Conditions: (1) Commercial General Liability (“CGL”) Insurance: The CGL insurance policy must be issued on an occurrence basis, written on a comprehensive general liability form, and must include coverage for liability arising from Contractor’s or its Subcontractor’s acts or omissions in the performance of the Work, including contractor’s protected coverage, contractual liability, products and completed operations, and broad form property damage, with limits of at least $2,000,000 per occurrence and at least $4,000,000 general aggregate. The CGL insurance coverage may be arranged under a single policy for the full limits required or by a combination of underlying policies with the balance provided by excess or umbrella policies, provided each such policy complies with the requirements set forth in this Section, including required endorsements. (2) Automobile Liability Insurance: The automobile liability insurance policy must provide coverage of at least $2,000,000 combined single-limit per accident for bodily injury, death, or property damage, including hired and non-owned auto liability. (3) Workers’ Compensation Insurance and Employer’s Liability: The workers’ compensation and employer’s liability insurance policy must comply with the requirements of the California Labor Code, providing coverage of at least $1,000,000 or as otherwise required by the statute. If Contractor is self-insured, Contractor must provide its Certificate of Permission to Self-Insure, duly authorized by the DIR. (4) Pollution Liability Insurance: The pollution liability insurance policy must be issued on an occurrence basis, providing coverage of at least $2,000,000 for all loss arising out of claims for bodily injury, death, property damage, or environmental damage caused by pollution conditions resulting from the Work. (5) Builder’s Risk Insurance: The builder’s risk insurance policy must be issued on an occurrence basis, for all-risk or “all perils” coverage on a 100% completed value basis on the insurable portion of the Project for the benefit of City. (B) Notice. Each certificate of insurance must state that the coverage afforded by the policy or policies will not be reduced, cancelled or allowed to expire without at least 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 42 30 days written notice to City, unless due to non-payment of premiums, in which case ten days written notice must be made to City. (C) Waiver of Subrogation. Each required policy must include an endorsement providing that the carrier will waive any right of subrogation it may have against City. (D) Required Endorsements. The CGL policy, automobile liability policy, pollution liability policy, and builder’s risk policy must include the following specific endorsements: (1) The City, including its Council, officials, officers, employees, agents, volunteers and consultants (collectively, “Additional Insured”) must be named as an additional insured for all liability arising out of the operations by or on behalf of the named insured, and the policy must protect the Additional Insured against any and all liability for personal injury, death or property damage or destruction arising directly or indirectly in the performance of the Contract. The additional insured endorsement must be provided using ISO form CG 20 10 11 85 or an equivalent form approved by the City. (2) The inclusion of more than one insured will not operate to impair the rights of one insured against another, and the coverages afforded will apply as though separate policies have been issued to each insured. (3) The insurance provided by Contractor is primary and no insurance held or owned by any Additional Insured may be called upon to contribute to a loss. (4) This policy does not exclude explosion, collapse, underground excavation hazard, or removal of lateral support. (E) Contractor’s Responsibilities. This Section 4.3 establishes the minimum requirements for Contractor’s insurance coverage in relation to this Project, but is not intended to limit Contractor’s ability to procure additional or greater coverage. Contractor is responsible for its own risk assessment and needs and is encouraged to consult its insurance provider to determine what coverage it may wish to carry beyond the minimum requirements of this Section. Contractor is solely responsible for the cost of its insurance coverage, including premium payments, deductibles, or self-insured retentions, and no Additional Insured will be responsible or liable for any of the cost of Contractor’s insurance coverage. (F) Deductibles and Self-Insured Retentions. Any deductibles or self-insured retentions that apply to the required insurance (collectively, “deductibles”) in excess of $100,000 are subject to approval by the City’s Risk Manager, acting in his or her sole discretion, and must be declared by Contractor when it submits its certificates of insurance and endorsements pursuant to this Section 4.3. If the City’s Risk Manager determines that the deductibles are unacceptably high, at City’s option, Contractor must either reduce or eliminate the deductibles as they apply to City and all required Additional Insured; or must provide a financial guarantee, to City’s satisfaction, guaranteeing payment of losses and related investigation, claim administration, and legal expenses. (G) Subcontractors. Contractor must ensure that each Subcontractor is required to maintain the same insurance coverage required under this Section 4.3, with respect to its performance of Work on the Project, including those requirements related to the Additional Insureds and waiver of subrogation, but excluding pollution liability or builder’s risk insurance unless otherwise specified in the Special Conditions. A Subcontractor may be eligible for reduced insurance coverage or limits, but only to the extent approved in writing in advance by the City’s Risk Manager. Contractor must confirm that each Subcontractor has complied with these insurance requirements before the Subcontractor 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 43 is permitted to begin Work on the Project. Upon request by the City, Contractor must provide certificates and endorsements submitted by each Subcontractor to prove compliance with this requirement. The insurance requirements for Subcontractors do not replace or limit the Contractor’s insurance obligations. Article 5 - Contract Time 5.1 Time is of the Essence. Time is of the essence in Contractor’s performance and completion of the Work, and Contractor must diligently prosecute the Work and complete it within the Contract Time. (A) General. Contractor must commence the Work on the date indicated in the Notice to Proceed and must fully complete the Work in strict compliance with all requirements of the Contract Documents and within the Contract Time. Contractor may not begin performing the Work before the date specified in the Notice to Proceed. (B) Authorization. Contractor is not entitled to compensation or credit for any Work performed before the date specified in the Notice to Proceed, with the exception of any schedules, submittals, or other requirements, if any, that must be provided or performed before issuance of the Notice to Proceed. (C) Rate of Progress. Contractor and its Subcontractors must, at all times, provide workers, materials, and equipment sufficient to maintain the rate of progress necessary to ensure full completion of the Work within the Contract Time. If City determines that Contractor is failing to prosecute the Work at a sufficient rate of progress, City may, in its sole discretion, direct Contractor to provide additional workers, materials, or equipment, or to work additional hours or days without additional cost to City, in order to achieve a rate of progress satisfactory to City. If Contractor fails to comply with City’s directive in this regard, City may, at Contractor’s expense, separately contract for additional workers, materials, or equipment or use City’s own forces to achieve the necessary rate of progress. Alternatively, City may terminate the Contract based on Contractor’s default. 5.2 Schedule Requirements. Contractor must prepare all schedules using standard, commercial scheduling software acceptable to the Engineer, and must provide the schedules in electronic and paper form as requested by the Engineer. In addition to the general scheduling requirements set forth below, Contractor must also comply with any scheduling requirements included in the Special Conditions or in the Technical Specifications. (A) Baseline (As-Planned) Schedule. Within ten calendar days following City’s issuance of the Notice to Proceed (or as otherwise specified in the Notice to Proceed), Contractor must submit to City for review and acceptance a baseline (as-planned) schedule using critical path methodology showing in detail how Contractor plans to perform and fully complete the Work within the Contract Time, including labor, equipment, materials and fabricated items. The baseline schedule must show the order of the major items of Work and the dates of start and completion of each item, including when the materials and equipment will be procured. The schedule must also include the work of all trades, reflecting anticipated labor or crew hours and equipment loading for the construction activities, and must be sufficiently comprehensive and detailed to enable progress to be monitored on a day-by-day basis. For each activity, the baseline schedule must be dated, provided in the format specified in the Contract Documents or as required by City, and must include, at a minimum, a description of the activity, the start and completion dates of the activity, and the duration of the activity. 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 44 (1) Specialized Materials Ordering. Within five calendar days following issuance of the Notice to Proceed, Contractor must order any specialized material or equipment for the Work that is not readily available from material suppliers. Contractor must also retain documentation of the purchase orders date(s). (B) City’s Review of Schedules. City will review and may note exceptions to the baseline schedule, and to the progress schedules submitted as required below, to assure completion of the Work within the Contract Time. Contractor is solely responsible for resolving any exceptions noted in a schedule and, within seven days, must correct the schedule to address the exceptions. City’s review or acceptance of Contractor’s schedules will not operate to waive or limit Contractor’s duty to complete the Project within the Contract Time, nor to waive or limit City’s right to assess liquidated damages for Contractor’s unexcused failure to do so. (C) Progress Schedules. After City accepts the final baseline schedule with no exceptions, Contractor must submit an updated progress schedule and three-week look- ahead schedule, in the format specified by City, for review and acceptance with each application for a progress payment, or when otherwise specified by City, until completion of the Work. The updated progress schedule must: show how the actual progress of the Work as constructed to date compares to the baseline schedule; reflect any proposed changes in the construction schedule or method of operations, including to achieve Project milestones within the Contract Time; and identify any actual or potential impacts to the critical path. Contractor must also submit periodic reports to City of any changes in the projected material or equipment delivery dates for the Project. (1) Float. The progress schedule must show early and late completion dates for each task. The number of days between those dates will be designated as the “float.” Any float belongs to the Project and may be allocated by the Engineer to best serve timely completion of the Project. (2) Failure to Submit Schedule. Reliable, up-to-date schedules are essential to efficient and cost-effective administration of the Project and timely completion. If Contractor fails to submit a schedule within the time periods specified in this Section, or submits a schedule to which City has noted exceptions that are not corrected, City may withhold up to ten percent from payment(s) otherwise due to Contractor until the exceptions are resolved, the schedule is corrected and resubmitted, and City has accepted the schedule. In addition, Contractor’s failure to comply with the schedule requirements in this Section 5.2 will be deemed a material default and a waiver of any claims for Excusable Delay or loss of productivity arising during any period when Contractor is out of compliance, subject only to the limits of Public Contract Code § 7102. (D) Recovery Schedule. If City determines that the Work is more than one week behind schedule, within seven days following written notice of such determination, Contractor must submit a recovery schedule, showing how Contractor intends to perform and complete the Work within the Contract Time, based on actual progress to date. (E) Effect of Acceptance. Contractor and its Subcontractors must perform the Work in accordance with the most current City-accepted schedule unless otherwise directed by City. City’s acceptance of a schedule does not operate to extend the time for completion of the Work or any component of the Work, and will not affect City’s right to assess liquidated damages for Contractor’s unexcused delay in completing the Work within the Contract Time. (F) Posting. Contractor must at all times prominently post a copy of the most current City-accepted progress or recovery schedule in its on-site office. 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 45 (G) Reservation of Rights. City reserves the right to direct the sequence in which the Work must be performed or to make changes in the sequence of the Work in order to facilitate the performance of work by City or others, or to facilitate City’s use of its property. The Contract Time or Contract Price may be adjusted to the extent such changes in sequence actually increase or decrease Contractor’s time or cost to perform the Work. (H) Authorized Working Days and Times. Contractor is limited to working Monday through Friday, excluding holidays, during City’s normal business hours, except as provided in the Special Conditions or as authorized in writing by City. City reserves the right to charge Contractor for additional costs incurred by City due to Work performed on days or during hours not expressly authorized in the Contract Documents, including reimbursement of costs incurred for inspection, testing, and construction management services. 5.3 Delay and Extensions of Contract Time. (A) Notice of Delay. If Contractor becomes aware of any actual or potential delay affecting the critical path, Contractor must promptly notify the Engineer in writing, regardless of the nature or cause of the delay, so that City has a reasonable opportunity to mitigate or avoid the delay. (B) Excusable Delay. The Contract Time may be extended if Contractor encounters “Excusable Delay,” which is an unavoidable delay in completing the Work within the Contract Time due to causes completely beyond Contractor’s control, and which Contractor could not have avoided or mitigated through reasonable care, planning, foresight, and diligence, provided that Contractor is otherwise fully performing its obligations under the Contract Documents. Grounds for Excusable Delay may include fire, natural disasters including earthquake or unusually severe weather, acts of terror or vandalism, epidemic, unforeseeable adverse government actions, unforeseeable actions of third parties, encountering unforeseeable hazardous materials, unforeseeable site conditions, or suspension for convenience under Article 13. The Contract Time will not be extended based on circumstances which will not unavoidably delay completing the Work within the Contract Time based on critical path analysis. (C) Weather Delays. A “Weather Delay Day” is a Working Day during which Contractor and its forces, including Subcontractors, are unable to perform more than 40% of the critical path Work scheduled for that day due to adverse weather conditions which impair the ability to safely or effectively perform the scheduled critical path Work that day. Adverse weather conditions may include rain, saturated soil, and Project site clean-up required due to adverse weather. Determination of what constitutes critical path Work scheduled for that day will be based on the most current, City-approved schedule. Contractor will be entitled to a non-compensable extension of the Contract Time for each Weather Delay Day in excess of the normal Weather Delay Days within a given month as determined by reliable records, including monthly rainfall averages, for the preceding ten years (or as otherwise specified in the Special Conditions or Specifications). (1) Based on historic records for the Project location from the Western Regional Climate Center, Contractor’s schedule should assume the following number of normal Weather Delay Days and precipitation for each month: Month # Normal Weather Precipitation Delay Days January 6 2.86 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 46 February 6 2.66 March 6 2.29 April 3 1.20 May 1 0.44 June 0 0.10 July 0 0.02 August 0 0.07 September 1 0.19 October 2 0.76 November 4 1.51 December 5 2.43 Total 34 14.53 (2) Contractor must fully comply with the applicable procedures in Articles 5 and 6 of the General Conditions regarding requests to modify the Contract Time. (3) Contractor will not be entitled to an extension of time for a Weather Delay Day to the extent Contractor is responsible for concurrent delay on that day. (4) Contractor must take reasonable steps to mitigate the consequences of Weather Delay Days, including prudent workforce management and protecting the Work, Project Site, materials, and equipment. (D) Non-Excusable Delay. Delay which Contractor could have avoided or mitigated through reasonable care, planning, foresight and diligence is “Non-Excusable Delay.” Contractor is not entitled to an extension of Contract Time or any compensation for Non- Excusable Delay, or for Excusable Delay that is concurrent with Non-Excusable Delay. Non-Excusable Delay includes delay caused by: (1) weather conditions which are normal for the location of the Project, as determined by reliable records, including monthly rainfall averages, for the preceding ten years; (2) Contractor’s failure to order equipment and materials sufficiently in advance of the time needed for completion of the Work within the Contract Time; (3) Contractor’s failure to provide adequate notification to utility companies or agencies for connections or services necessary for completion of the Work within the Contract Time; (4) foreseeable conditions which Contractor could have ascertained from reasonably diligent inspection of the Project site or review of the Contract Documents or other information provided or available to Contractor; (5) Contractor’s failure, refusal, or financial inability to perform the Work within the Contract Time, including insufficient funds to pay its Subcontractors or suppliers; (6) performance or non-performance by Contractor’s Subcontractors or suppliers; (7) the time required to respond to excessive RFIs (see Section 2.5(G)); 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 47 (8) delayed submission of required submittals, or the time required for correction and resubmission of defective submittals; (9) time required for repair of, re-testing, or re-inspection of defective Work; (10) enforcement of Laws by City, or outside agencies with jurisdiction over the Work; or (11) City’s exercise or enforcement of any of its rights or Contractor’s duties pursuant to the Contract Documents, including correction of defective Work, extra inspections or testing due to non-compliance with Contract requirements, safety compliance, environmental compliance, or rejection and return of defective or deficient submittals. (E) Compensable Delay. Pursuant to Public Contract Code § 7102, in addition to entitlement to an extension of Contract Time, Contractor is entitled to compensation for costs incurred due to delay caused solely by City, when that delay is unreasonable under the circumstances involved and not within the contemplation of the parties (“Compensable Delay”). Contractor is not entitled to an extension of Contract Time or recovery of costs for Compensable Delay that is concurrent with Non-Excusable Delay. Delay due to causes that are beyond the control of either City or Contractor, including Weather Delay Days, discovery of Historic or Archeological Items pursuant to Section 7.18, or the actions or inactions of third parties or other agencies, is not Compensable Delay, and will only entitle Contractor to an extension of time commensurate with the time lost due to such delay. (F) Recoverable Costs. Contractor is not entitled to compensation for Excusable Delay unless it is Compensable Delay, as defined above. Contractor is entitled to recover only the actual, direct, reasonable, and substantiated costs (“Recoverable Costs”) for each working day that the Compensable Delay prevents Contractor from proceeding with more than 50% of the critical path Work scheduled for that day, based on the most recent progress schedule accepted by City. Recoverable Costs will not include home office overhead or lost profit. (G) Request for Extension of Contract Time or Recoverable Costs. A request for an extension of Contract Time or any associated Recoverable Costs must be submitted in writing to City within ten calendar days of the date the delay is first encountered, even if the duration of the delay is not yet known at that time, or any entitlement to the Contract Time extension or to the Recoverable Costs will be deemed waived. In addition to complying with the requirements of this Article 5, the request must be submitted in compliance with the Change Order request procedures in Article 6 below. Strict compliance with these requirements is necessary to ensure that any delay or consequences of delay may be mitigated as soon as possible, and to facilitate cost- efficient administration of the Project and timely performance of the Work. Any request for an extension of Contract Time or Recoverable Costs that does not strictly comply with all of the requirements of Article 5 and Article 6 will be deemed waived. (1) Required Contents. The request must include a detailed description of the cause(s) of the delay and must also describe the measures that Contractor has taken to mitigate the delay and/or its effects, including efforts to mitigate the cost impact of the delay, such as by workforce management or by a change in sequencing. If the delay is still ongoing at the time the request is submitted, the request should also include Contractor’s plan for continued mitigation of the delay or its effects. 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 48 (2) Delay Days and Costs. The request must specify the number of days of Excusable Delay claimed or provide a realistic estimate if the duration of the delay is not yet known. If Contractor believes it is entitled to Recoverable Costs for Compensable Delay, the request must specify the amount and basis for the Recoverable Costs that are claimed or provide a realistic estimate if the amount is not yet known. Any estimate of delay duration or cost must be updated in writing and submitted with all required supporting documentation as soon as the actual time and cost is known. The maximum extension of Contract Time will be the number of days, if any, by which an Excusable Delay or a Compensable Delay exceeds any concurrent Non-Excusable Delay. Contractor is entitled to an extension of Contract Time, or compensation for Recoverable Costs, only if, and only to the extent that, such delay will unavoidably delay Final Completion. (3) Supporting Documentation. The request must also include any and all supporting documentation necessary to evidence the delay and its actual impacts, including scheduling and cost impacts with a time impact analysis using critical path methodology and demonstrating the unavoidable delay to Final Completion. The time impact analysis must be submitted in a form or format acceptable to City. (4) Burden of Proof. Contractor has the burden of proving that: the delay was an Excusable or Compensable Delay, as defined above; Contractor has fully complied with its scheduling obligations in Section 5.2, Schedule Requirements; Contractor has made reasonable efforts to mitigate the delay and its schedule and cost impacts; the delay will unavoidably result in delaying Final Completion; and any Recoverable Costs claimed by Contractor were actually incurred and were reasonable under the circumstances. (5) Legal Compliance. Nothing in this Section 5.3 is intended to require the waiver, alteration, or limitation of the applicability of Public Contract Code § 7102. (6) No Waiver. Any grant of an extension of Contract Time, or compensation for Recoverable Costs due to Compensable Delay, will not operate as a waiver of City’s right to assess liquidated damages for Non-Excusable Delay. (7) Dispute Resolution. In the event of a dispute over entitlement to an extension of Contract Time or compensation for Recoverable Costs, Contractor may not stop Work pending resolution of the dispute, but must continue to comply with its duty to diligently prosecute the performance and timely completion of the Work. Contractor’s sole recourse for an unresolved dispute based on City’s rejection of a Change Order request for an extension of Contract Time or compensation for Recoverable Costs is to comply with the dispute resolution provisions set forth in Article 12 below. 5.4 Liquidated Damages. It is expressly understood that if Final Completion is not achieved within the Contract Time, City will suffer damages from the delay that are difficult to determine and accurately specify. Pursuant to Public Contract Code § 7203, if Contractor fails to achieve Final Completion within the Contract Time, City will charge Contractor in the amount specified in the Contract for each day that Final Completion is delayed beyond the Contract Time, as liquidated damages and not as a penalty. Any waiver of accrued liquidated damages, in whole or in part, is subject to approval of the City Council or its authorized delegee. (A) Liquidated Damages. Liquidated damages will not be assessed for any Excusable or Compensable Delay, as set forth above. 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 49 (B) Milestones. Liquidated damages may also be separately assessed for failure to meet milestones specified elsewhere in the Contract Documents. (C) Setoff. City is entitled to deduct the amount of liquidated damages assessed against any payments otherwise due to Contractor, including progress payments, Final Payment, or unreleased retention. If there are insufficient Contract funds remaining to cover the full amount of liquidated damages assessed, City is entitled to recover the balance from Contractor or its performance bond surety. (D) Occupancy or Use. Occupancy or use of the Project in whole or in part prior to Final Completion does not constitute City’s acceptance of the Project and will not operate as a waiver of City’s right to assess liquidated damages for Contractor’s Non-Excusable Delay in achieving Final Completion. (E) Other Remedies. City’s right to liquidated damages under this Section applies only to damages arising from Contractor’s Non-Excusable Delay or failure to complete the Work within the Contract Time. City retains its right to pursue all other remedies under the Contract for other types of damage, including damage to property or persons, costs or diminution in value from defective materials or workmanship, costs to repair or complete the Work, or other liability caused by Contractor. Article 6 - Contract Modification 6.1 Contract Modification. Subject to the limited exception set forth in subsection (D) below, any change in the Work or the Contract Documents, including the Contract Price or Contract Time, will not be a valid and binding change to the Contract unless it is formalized in a Change Order, including a “no-cost” Change Order or a unilateral Change Order. Changes in the Work pursuant to this Article 6 will not operate to release, limit, or abridge Contractor’s warranty obligations pursuant to Article 11 or any obligations of Contractor’s bond sureties. (A) City-Directed Changes. City may direct changes in the scope or sequence of Work or the requirements of the Contract Documents, without invalidating the Contract. Such changes may include Extra Work as set forth in subsection (C) below, or deletion or modification of portions of the Work. Contractor must promptly comply with City-directed changes in the Work in accordance with the original Contract Documents, even if Contractor and City have not yet reached agreement as to adjustments to the Contract Price or Contract Time for the change in the Work or for the Extra Work. Contractor is not entitled to extra compensation for cost savings resulting from “value engineering” pursuant to Public Contract Code § 7101, except to the extent authorized in advance by City in writing, and subject to any applicable procedural requirements for submitting a proposal for value engineering cost savings. (B) Disputes. In the event of a dispute over entitlement to or the amount of a change in Contract Time or a change in Contract Price related to a City-directed change in the Work, Contractor must perform the Work as directed and may not delay its Work or cease Work pending resolution of the dispute, but must continue to comply with its duty to diligently prosecute the performance and timely completion of the Work, including the Work in dispute. Likewise, in the event that City and Contractor dispute whether a portion or portions of the Work are already required by the Contract Documents or constitute Extra Work, or otherwise dispute the interpretation of any portion(s) of the Contract Documents, Contractor must perform the Work as directed and may not delay its Work or cease Work pending resolution of the dispute, but must continue to comply with its duty to diligently prosecute the performance and timely completion of the Work, including the Work in dispute, as directed by City. If Contractor refuses to perform the Work in dispute, 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 50 City may, acting in its sole discretion, elect to delete the Work from the Contract and reduce the Contract Price accordingly, and self-perform the Work or direct that the Work be performed by others. Alternatively, City may elect to terminate the Contract for convenience or for cause. Contractor’s sole recourse for an unresolved dispute related to changes in the Work or performance of any Extra Work is to comply with the dispute resolution provisions set forth in Article 12, below. (C) Extra Work. City may direct Contractor to perform Extra Work related to the Project. Contractor must promptly perform any Extra Work as directed or authorized by City in accordance with the original Contract Documents, even if Contractor and City have not yet reached agreement on adjustments to the Contract Price or Contract Time for such Extra Work. If Contractor believes it is necessary to perform Extra Work due to changed conditions, Contractor must promptly notify the Engineer in writing, specifically identifying the Extra Work and the reason(s) the Contractor believes it is Extra Work. This notification requirement does not constitute a Change Order request pursuant to Section 6.2, below. Contractor must maintain detailed daily records that itemize the cost of each element of Extra Work, and sufficiently distinguish the direct cost of the Extra Work from the cost of other Work performed. For each day that Contractor performs Extra Work, or Work that Contractor contends is Extra Work, Contractor must submit no later than the following Working Day, a daily report of the Extra Work performed that day and the related costs, together with copies of certified payroll, invoices, and other documentation substantiating the costs (“Extra Work Report”). The Engineer will make any adjustments to Contractor’s Extra Work Report(s) based on the Engineer’s records of the Work. When an Extra Work Report(s) is agreed on and signed by both City and Contractor, the Extra Work Report(s) will become the basis for payment under a duly authorized and signed Change Order. Failure to submit the required documentation by close of business on the next Working Day is deemed a full and complete waiver for any change in the Contract Price or Contract Time for any Extra Work performed that day. (D) Minor Changes and RFIs. Minor field changes, including RFI replies from City, that do not affect the Contract Price or Contract Time and that are approved by the Engineer acting within his or her scope of authority, do not require a Change Order. By executing an RFI reply from City, Contractor agrees that it will perform the Work as clarified therein, with no change to the Contract Price or Contract Time. (E) Remedy for Non-Compliance. Contractor’s failure to promptly comply with a City-directed change is deemed a material breach of the Contract, and in addition to all other remedies available to it, City may, at its sole discretion, hire another contractor or use its own forces to complete the disputed Work at Contractor’s sole expense, and may deduct the cost from the Contract Price. 6.2 Contractor Change Order Requests. Contractor must submit a request or proposal for a change in the Work, compensation for Extra Work, or a change in the Contract Price or Contract Time as a written Change Order request or proposal. (A) Time for Submission. Any request for a change in the Contract Price or the Contract Time must be submitted in writing to the Engineer within ten calendar days of the date that Contractor first encounters the circumstances, information or conditions giving rise to the Change Order request, even if the total amount of the requested change in the Contract Price or impact on the Contract Time is not yet known at that time. If City requests that Contractor propose the terms of a Change Order, unless otherwise specified in City’s request, Contractor must provide the Engineer with a written proposal for the change in the Contract Price or Contract Time within five working days of receiving City’s request, in a form satisfactory to the Engineer. 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 51 (B) Required Contents. Any Change Order request or proposal submitted by Contractor must include a complete breakdown of actual or estimated costs and credits, and must itemize labor, materials, equipment, taxes, insurance, subcontract amounts, and, if applicable, Extra Work Reports. Any estimated cost must be updated in writing as soon as the actual amount is known. (C) Required Documentation. All claimed costs must be fully documented, and any related request for an extension of time or delay-related costs must be included at that time and in compliance with the requirements of Article 5 of the General Conditions. Upon request, Contractor must permit City to inspect its original and unaltered bidding records, subcontract agreements, subcontract change orders, purchase orders, invoices, or receipts associated with the claimed costs. (D) Required Form. Contractor must use City’s form(s) for submitting all Change Order requests or proposals, unless otherwise specified by City. (E) Certification. All Change Order requests must be signed by Contractor and must include the following certification: “The undersigned Contractor certifies under penalty of perjury that its statements and representations in this Change Order request are true and correct. Contractor warrants that this Change Order request is comprehensive and complete as to the Work or changes referenced herein, and agrees that any known or foreseeable costs, expenses, or time extension requests not included herein, are deemed waived.” 6.3 Adjustments to Contract Price. The amount of any increase or decrease in the Contract Price will be determined based on one of the following methods listed below, in the order listed with unit pricing taking precedence over the other methods. Markup applies only to City-authorized time and material Work, and does not apply to any other payments to Contractor. For Work items or components that are deleted in their entirety, Contractor will only be entitled to compensation for those direct, actual, and documented costs (including restocking fees), reasonably incurred before Contractor was notified of the City’s intent to delete the Work, with no markup for overhead, profit, or other indirect costs. (A) Unit Pricing. Amounts previously provided by Contractor in the form of unit prices, either in a bid schedule or in a post-award schedule of values pursuant to Section 8.1, Schedule of Values, will apply to determine the price for the affected Work, to the extent applicable unit prices have been provided for that type of Work. No additional markup for overhead, profit, or other indirect costs will be added to the calculation. (B) Lump Sum. A mutually agreed upon, all-inclusive lump sum price for the affected Work with no additional markup for overhead, profit, or other indirect costs. (C) Time and Materials. On a time and materials basis, if and only to the extent compensation on a time and materials basis is expressly authorized by City in advance of Contractor’s performance of the Work and subject to any not-to-exceed limit. Time and materials compensation for increased costs or Extra Work (but not decreased costs or deleted Work), will include allowed markup for overhead, profit, and other indirect costs, and which may include a not-to-exceed limit, calculated as the total of the following sums, the cumulative total of which may not exceed the maximum markup rate of 15%: (1) All direct labor costs provided by the Contractor, excluding superintendence, project management, or administrative costs, plus 15% markup; 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 52 (2) All direct material costs provided by the Contractor, including sales tax, plus 15% markup; (3) All direct plant and equipment rental costs provided by the Contractor, plus 15% markup; (4) All direct additional subcontract costs plus 10% markup for Work performed by Subcontractors; and (5) Increased bond or insurance premium costs computed at 1.5% of total of the previous four sums. 6.4 Unilateral Change Order. If the parties dispute the terms of a proposed Change Order, including disputes over the amount of compensation or extension of time that Contractor has requested, the value of deleted or changed Work, what constitutes Extra Work, or quantities used, City may elect to issue a unilateral Change Order, directing performance of the Work, and authorizing a change in the Contract Price or Contract Time for the adjustment to compensation or time that the City believes is merited. Contractor’s sole recourse to dispute the terms of a unilateral Change Order is to submit a timely Claim pursuant to Article 12, below. 6.5 Non-Compliance Deemed Waiver. Contractor waives its entitlement to any increase in the Contract Price or Contract Time if Contractor fails to fully comply with the provisions of this Article. Contractor will not be paid for unauthorized Extra Work. Article 7 - General Construction Provisions 7.1 Permits, Fees, Business License, and Taxes. (A) Permits, Fees, and City Business License. Contractor must obtain and pay for all permits, fees, or licenses required to perform the Work, including a City business license. Contractor must cooperate with and provide notifications to all government agencies with jurisdiction over the Project, as may be required. Contractor must provide City with copies of all records of permits and permit applications, payment of required fees, and any licenses required for the Work. (B) Taxes. Contractor must pay for all taxes on labor, material and equipment, except Federal Excise Tax to the extent that City is exempt from Federal Excise Tax. 7.2 Temporary Facilities. Contractor must provide, at Contractor’s sole expense, any and all temporary facilities for the Project, including an onsite staging area for materials and equipment, a field office, sanitary facilities, utilities, storage, scaffolds, barricades, walkways, and any other temporary structure required to safely perform the Work along with any incidental utility services. The location of all temporary facilities must be approved by the City prior to installation. Temporary facilities must be safe and adequate for the intended use and installed and maintained in accordance with Laws and the Contract Documents. Contractor must fence and screen the Project site and, if applicable, any separate Worksites, including the staging area, and its operation must minimize inconvenience to neighboring properties. Additional provisions pertaining to temporary facilities may be included in the Specifications or Special Conditions. (A) Utilities. Contractor must install and maintain the power, water, sewer and all other utilities required for the Project site, including the piping, wiring, internet and wifi connections, and any related equipment necessary to maintain the temporary facilities. 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 53 (B) Removal and Repair. Contractor must promptly remove all such temporary facilities when they are no longer needed or upon completion of the Work, whichever comes first. Contractor must promptly repair any damage to City’s property or to other property caused by the installation, use, or removal of the temporary facilities, and must promptly restore the property to its original or intended condition. 7.3 Noninterference and Site Management. Contractor must avoid interfering with City’s use of its property at or adjacent to the Project site, including use of roadways, entrances, parking areas, walkways, and structures. Contractor must also minimize disruption of access to private property in the Project vicinity. Contractor must coordinate with affected property owners, tenants, and businesses, and maintain some vehicle and pedestrian access to their residences or properties at all times. Temporary access ramps, fencing or other measures must be provided as needed. Before blocking access to a private driveway or parking lot, Contractor must provide effective notice to the affected parties at least 48 hours in advance of the pending closure and allow them to remove vehicles. Private driveways, residences and parking lots must have access to a roadway during non-Work hours. (A) Offsite Acquisition. Unless otherwise provided by City, Contractor must acquire, use and dispose of, at its sole expense, any additional Worksites, licenses, easements, and temporary facilities necessary to access and perform the Work. (B) Offsite Staging Area and Field Office. If additional space beyond the Project site is needed, such as for the staging area or the field office, Contractor may need to make arrangements with the nearby property owner(s) to secure the space. Before using or occupying any property owned by a third party, Contractor must provide City with a copy of the necessary license agreement, easement, or other written authorization from the property owner, together with a written release from the property owner holding City harmless from any related liability, in a form acceptable to the City Attorney. (C) Traffic Management. Contractor must provide traffic management and traffic controls as specified in the Contract Documents, as required by Laws, and as otherwise required to ensure the public and worker safety, and to avoid interference with public or private operations or the normal flow of vehicular, bicycle, or pedestrian traffic. 7.4 Signs. No signs may be displayed on or about City’s property, except signage which is required by Laws or by the Contract Documents, without City’s prior written approval as to size, design, and location. 7.5 Project Site and Nearby Property Protections. (A) General. Contractor is responsible at all times, on a 24-hour basis and at its sole cost, for protecting the Work, the Project site, and the materials and equipment to be incorporated into the Work, until the City has accepted the Project, excluding any exceptions to acceptance, if any. Except as specifically authorized by City, Contractor must confine its operations to the area of the Project site indicated in the Plans and Specifications. Contractor is liable for any damage caused by Contractor or its Subcontractors to the Work, City’s property, the property of adjacent or nearby property owners and the work or personal property of other contractors working for City, including damage related to Contractor’s failure to adequately secure the Work or any Worksite. (1) Subject to City’s approval, Contractor will provide and install safeguards to protect the Work; any Worksite, including the Project site; City’s real or personal property and the real or personal property of adjacent or nearby property owners, including plant and tree protections. 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 54 (2) City wastewater systems may not be interrupted. If the Work disrupts existing sewer facilities, Contractor must immediately notify City and establish a plan, subject to City’s approval, to convey the sewage in closed conduits back into the sanitary sewer system. Sewage must not be permitted to flow in trenches or be covered by backfill. (3) Contractor must remove with due care, and store at City’s request, any objects or material from the Project site that City will salvage or reuse at another location. (4) If directed by Engineer, Contractor must promptly repair or replace any property damage, as specified by the Engineer. However, acting in its sole discretion, City may elect to have the property damage remedied otherwise, and may deduct the cost to repair or replace the damaged property from payment otherwise due to Contractor. (5) Contractor will not permit any structure or infrastructure to be loaded in a manner that will damage or endanger the integrity of the structure or infrastructure. (B) Securing Project Site. After completion of Work each day, Contractor must secure the Project site and, to the extent feasible, make the area reasonably accessible to the public unless City approves otherwise. All excess materials and equipment not protected by approved traffic control devices must be relocated to the staging area or demobilized. Trench spoils must be hauled off the Project site daily and open excavations must be protected with steel plates. Contractor and Subcontractor personnel may not occupy or use the Project site for any purpose during non-Work hours, except as may be provided in the Contract Documents or pursuant to prior written authorization from City. (C) Unforeseen Conditions. If Contractor encounters facilities, utilities, or other unknown conditions not shown on or reasonably inferable from the Plans or apparent from inspection of the Project site, Contractor must immediately notify the City and promptly submit a Request for Information to obtain further directions from the Engineer. Contractor must avoid taking any action which could cause damage to the facilities or utilities pending further direction from the Engineer. The Engineer’s written response will be final and binding on Contractor. If the Engineer’s subsequent direction to Contractor affects Contractor’s cost or time to perform the Work, Contractor may submit a Change Order request as set forth in Article 6 above. (D) Support; Adjacent Properties. Contractor must provide, install, and maintain all shoring, bracing, and underpinning necessary to provide support to City’s property and adjacent properties and improvements thereon. Contractor must provide notifications to adjacent property owners as may be required by Laws. See also, Section 7.15, Trenching of Five Feet or More. (E) Notification of Property Damage. Contractor must immediately notify the City of damage to any real or personal property resulting from Work on the Project. Contractor must immediately provide a written report to City of any such property damage in excess of $500 (based on estimated cost to repair or replace) within 24 hours of the occurrence. The written report must include: (1) the location and nature of the damage, and the owner of the property, if known; (2) the name and address of each employee of Contractor or any Subcontractor involved in the damage; (3) a detailed description of the incident, including precise location, time, and names and contact information for known witnesses; and (4) a police or first responder report, if applicable. If Contractor is required to file an accident report with another government agency, Contractor will provide a copy of the report to City. 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 55 7.6 Materials and Equipment. (A) General. Unless otherwise specified, all materials and equipment required for the Work must be new, free from defects, and of the best grade for the intended purpose, and furnished in sufficient quantities to ensure the proper and expeditious performance of the Work. Contractor must employ measures to preserve the specified quality and fitness of the materials and equipment. Unless otherwise specified, all materials and equipment required for the Work are deemed to include all components required for complete installation and intended operation and must be installed in accordance with the manufacturer’s recommendations or instructions. Contractor is responsible for all shipping, handling, and storage costs associated with the materials and equipment required for the Work. Contractor is responsible for providing security and protecting the Work and all of the required materials, supplies, tools and equipment at Contractor’s sole cost until City has formally accepted the Project as set forth in Section 11.1, Final Completion. Contractor will not assign, sell, mortgage, or hypothecate any materials or equipment for the Project, or remove any materials or equipment that have been installed or delivered. (B) City-Provided. If the Work includes installation of materials or equipment to be provided by City, Contractor is solely responsible for the proper examination, handling, storage, and installation in accordance with the Contract Documents. Contractor must notify City of any defects discovered in City-provided materials or equipment, sufficiently in advance of scheduled use or installation to afford adequate time to procure replacement materials or equipment as needed. Contractor is solely responsible for any loss of or damage to such items which occurs while the items are in Contractor’s custody and control, the cost of which may be offset from the Contract Price and deducted from any payment(s) due to Contractor. (C) Intellectual Property Rights. Contractor must, at its sole expense, obtain any authorization or license required for use of patented or copyright-protected materials, equipment, devices or processes that are incorporated into the Work. Contractor’s indemnity obligations in Article 4 apply to any claimed violation of intellectual property rights in violation of this provision. 7.7 Substitutions. (A) “Or Equal.” Any Specification designating a material, product, or thing (collectively, “item”) or service by specific brand or trade name, followed by the words “or equal,” is intended only to indicate the quality and type of item or service desired, and Contractor may request use of any equal item or service. Unless otherwise stated in the Specifications, any reference to a specific brand or trade name for an item that is used solely for the purpose of describing the type of item desired, will be deemed to be followed by the words “or equal.” A substitution will only be approved if it is a true “equal” item in every aspect of design, function, and quality, as determined by City, including dimensions, weight, maintenance requirements, durability, fit with other elements, and schedule impacts. (B) Request for Substitution. A post-award request for substitution of an item or service must be submitted in writing to the Engineer for approval in advance, within the applicable time period provided in the Contract Documents. If no time period is specified, the substitution request may be submitted any time within 35 days after the date of award of the Contract, or sufficiently in advance of the time needed to avoid delay of the Work, whichever is earlier. 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 56 (C) Substantiation. Any available data substantiating the proposed substitute as an equal item or service must be submitted with the written request for substitution. Contractor’s failure to timely provide all necessary substantiation, including any required test results as soon as they are available, is grounds for rejection of the proposed substitution, without further review. (D) Burden of Proving Equality. Contractor has the burden of proving the equality of the proposed substitution at Contractor’s sole cost. City has sole discretion to determine whether a proposed substitution is equal, and City’s determination is final. (E) Approval or Rejection. If the proposed substitution is approved, Contractor is solely responsible for any additional costs or time associated with the substituted item or service. If the proposed substitution is rejected, Contractor must, without delay, install the item or use the service as specified by City. (F) Contractor’s Obligations. City’s approval of a proposed substitution will not relieve Contractor from any of its obligations under the Contract Documents. In the event Contractor makes an unauthorized substitution, Contractor will be solely responsible for all resulting cost impacts, including the cost of removal and replacement and the impact to other design elements. 7.8 Testing and Inspection. (A) General. All materials, equipment, and workmanship used in the Work are subject to inspection and testing by City at all times and locations during construction and/or fabrication and at any Worksite, including at shops and yards as well as at the Project site. All manufacturers’ application or installation instructions must be provided to the Inspector at least ten days prior to the first such application or installation. Contractor must, at all times, make the Work available for testing or inspection. Neither City’s inspection or testing of Work, nor its failure to do so, operate to waive or limit Contractor’s duty to complete the Work in accordance with the Contract Documents. (B) Scheduling and Notification. Contractor must cooperate with City in coordinating the inspections and testing. Contractor must submit samples of materials, at Contractor’s expense, and schedule all tests required by the Contract Documents in time to avoid any delay to the progress of the Work. Contractor must notify the Engineer no later than noon of the Working Day before any inspection or testing and must provide timely notice to the other necessary parties as specified in the Contract Documents. If Contractor schedules an inspection or test beyond regular Work hours, or on a Saturday, Sunday, or recognized City holiday, Contractor must notify the Engineer at least two Working Days in advance for approval. If approved, Contractor must reimburse City for the cost of the overtime inspection or testing. Such costs, including the City’s hourly costs for required personnel, may be deducted from payments otherwise due to Contractor. (C) Responsibility for Costs. City will bear the initial cost of inspection and testing to be performed by independent testing consultants retained by City, subject to the following exceptions: (1) Contractor will be responsible for the costs of any subsequent tests which are required to substantiate compliance with the Contract Documents, and any associated remediation costs. (2) Contractor will be responsible for inspection costs, at City’s hourly rates, for inspection time lost because the Work is not ready or Contractor fails to appear for a scheduled inspection. 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 57 (3) If any portion of the Work that is subject to inspection or testing is covered or concealed by Contractor prior to the inspection or testing, Contractor will bear the cost of making that portion of the Work available for the inspection or testing required by the Contract Documents, and any associated repair or remediation costs. (4) Contractor is responsible for properly shoring all compaction test sites deeper than five feet below grade, as required under Section 7.15 below. (5) Any Work or material that is defective or fails to comply with the requirements of the Contract Documents must be promptly repaired, removed, replaced, or corrected by Contractor, at Contractor’s sole expense, even if that Work or material was previously inspected or included in a progress payment. (D) Contractor’s Obligations. Contractor is solely responsible for any delay occasioned by remediation of defective or noncompliant Work or material. Inspection of the Work does not in any way relieve Contractor of its obligations to perform the Work as specified. Any Work done without the required inspection(s) will also be subject to rejection by City. (E) Distant Locations. If required off-site testing or inspection must be conducted at a location more than 100 miles from the Project site, Contractor is solely responsible for the additional travel costs required for testing and/or inspection at such locations. (F) Final Inspection. The provisions of this Section 7.8 also apply to final inspection under Article 11, Completion and Warranty Provisions. 7.9 Project Site Conditions and Maintenance. Contractor must at all times, on a 24-hour basis and at its sole cost, maintain the Project site and staging and storage areas in clean, neat, and sanitary condition and in compliance with all Laws pertaining to safety, air quality, and dust control. Adequate toilets must be provided, and properly maintained and serviced for all workers on the Project site, located in a suitably secluded area, subject to City’s prior approval. Contractor must also, on a daily basis and at its sole cost, remove and properly dispose of the debris and waste materials from the Project site. (A) Air Emissions Control. Contractor must not discharge smoke or other air contaminants into the atmosphere in violation of any Laws. (B) Dust and Debris. Contractor must minimize and confine dust and debris resulting from the Work. Contractor must abate dust nuisance by cleaning, sweeping, and immediately sprinkling with water excavated areas of dirt or other materials prone to cause dust, and within one hour after the Engineer notifies Contractor that an airborne nuisance exists. The Engineer may direct that Contractor provide an approved water- spraying truck for this purpose. If water is used for dust control, Contractor will only use the minimum necessary. Contractor must take all necessary steps to keep waste water out of streets, gutters, or storm drains. See Section 7.19, Environmental Control. If City determines that the dust control is not adequate, City may have the work done by others and deduct the cost from the Contract Price. Contractor will immediately remove any excess excavated material from the Project site and any dirt deposited on public streets. (C) Clean up. Before discontinuing Work in an area, Contractor must clean the area and remove all debris and waste along with the construction equipment, tools, machinery, and surplus materials. 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 58 (1) Except as otherwise specified, all excess Project materials, and the materials removed from existing improvements on the Project site with no salvage value or intended reuse by City, will be Contractor’s property. (2) Hauling trucks and other vehicles leaving the Project site must be cleaned of exterior mud or dirt before traveling on City streets. Materials and loose debris must be delivered and loaded to prevent dropping materials or debris. Contractor must immediately remove spillage from hauling on any publicly traveled way. Streets affected by Work on the Project must be kept clean by street sweeping. (D) Disposal. Contractor must dispose of all Project debris and waste materials in a safe and legal manner. Contractor may not burn or bury waste materials on the Project site. Contractor will not allow any dirt, refuse, excavated material, surplus concrete or mortar, or any associated washings, to be disposed of onto streets, into manholes or into the storm drain system. (E) Completion. At the completion of the Work, Contractor must remove from the Project site all of its equipment, tools, surplus materials, waste materials and debris, presenting a clean and neat appearance. Before demobilizing from the Project site, Contractor must ensure that all surfaces are cleaned, sealed, waxed, or finished as applicable, and that all marks, stains, paint splatters, and the like have been properly removed from the completed Work and the surrounding areas. Contractor must ensure that all parts of the construction are properly joined with the previously existing and adjacent improvements and conditions. Contractor must provide all cutting, fitting and patching needed to accomplish that requirement. Contractor must also repair or replace all existing improvements that are damaged or removed during the Work, both on and off the Project site, including curbs, sidewalks, driveways, fences, signs, utilities, street surfaces and structures. Repairs and replacements must be at least equal to the previously existing improvements, and the condition, finish and dimensions must match the previously existing improvements. Contractor must restore to original condition all property or items that are not designated for alteration under the Contract Documents and leave each Worksite clean and ready for occupancy or use by City. (F) Non-Compliance. If Contractor fails to comply with its maintenance and cleanup obligations or any City clean up order, City may, acting in its sole discretion, elect to suspend the Work until the condition(s) is corrected with no increase in the Contract Time or Contract Price, or undertake appropriate cleanup measures without further notice and the cost will be deducted from any amounts due or to become due to Contractor. 7.10 Instructions and Manuals. Contractor must provide to City three copies each of all instructions and manuals required by the Contract Documents, unless otherwise specified. These must be complete as to drawings, details, parts lists, performance data, and other information that may be required for City to easily maintain and service the materials and equipment installed for this Project. (A) Submittal Requirements. All manufacturers’ application or installation instructions must be provided to City at least ten days prior to the first such application. The instructions and manuals, along with any required guarantees, must be delivered to City for review. (B) Training. Contractor or its Subcontractors must train City’s personnel in the operation and maintenance of any complex equipment or systems as a condition precedent to Final Completion, if required in the Contract Documents. 7.11 As-built Drawings. Contractor and its Subcontractors must prepare and maintain at the Project site a detailed, complete and accurate as-built set of the Plans which will be used 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 59 solely for the purpose of recording changes made in any portion of the original Plans in order to create accurate record drawings at the end of the Project. (A) Duty to Update. The as-built drawings must be updated as changes occur, on a daily basis if necessary. City may withhold the estimated cost for City to have the as-built drawings prepared from payments otherwise due to Contractor, until the as-built drawings are brought up to date to the satisfaction of City. Actual locations to scale must be identified on the as-built drawings for all runs of mechanical and electrical work, including all site utilities installed underground, in walls, floors, or otherwise concealed. Deviations from the original Plans must be shown in detail. The exact location of all main runs, whether piping, conduit, ductwork or drain lines, must be shown by dimension and elevation. The location of all buried pipelines, appurtenances, or other improvements must be represented by coordinates and by the horizontal distance from visible above- ground improvements. (B) Final Completion. Contractor must verify that all changes in the Work are depicted in the as-built drawings and must deliver the complete set of as-built drawings to the Engineer for review and acceptance as a condition precedent to Final Completion and Final Payment. 7.12 Existing Utilities. (A) General. The Work may be performed in developed, urban areas with existing utilities, both above and below ground, including utilities identified in the Contract Documents or in other informational documents or records. Contractor must take due care to locate identified or reasonably identifiable utilities before proceeding with trenching, excavation, or any other activity that could damage or disrupt existing utilities. This may include excavation with small equipment, potholing, or hand excavation, and, if practical, using white paint or other suitable markings to delineate the area to be excavated. Except as otherwise provided herein, Contractor will be responsible for costs resulting from damage to identified or reasonably identifiable utilities due to Contractor’s negligence or failure to comply with the Contract Documents, including the requirements in this Article 7. (B) Unidentified Utilities. Pursuant to Government Code § 4215, if, during the performance of the Work, Contractor discovers utility facilities not identified by City in the Contract Documents, Contractor must immediately provide written notice to City and the utility. City assumes responsibility for the timely removal, relocation, or protection of existing main or trunkline utility facilities located on the Project site if those utilities are not identified in the Contract Documents. Contractor will be compensated in accordance with the provisions of the Contract Documents for the costs of locating, repairing damage not due to Contractor’s failure to exercise reasonable care, and removing or relocating utility facilities not indicated in the Plans or Specifications with reasonable accuracy, and for equipment on the Project necessarily idled during such work. Contractor will not be assessed liquidated damages for delay in completion of the Work, to the extent the delay was caused by City’s failure to provide for removal or relocation of the utility facilities. 7.13 Notice of Excavation. Contractor must comply with all applicable requirements in Government Code §§ 4216 through 4216.5, which are incorporated by reference herein. Government Code § 4216.2 requires that, except in an emergency, Contractor must contact the appropriate regional notification center, or Underground Services Alert, at least two working days, but not more than 14 calendar days, before starting any excavation if the excavation will be conducted in an area that is known, or reasonably should be known, to contain subsurface installations. Contractor may not begin excavation until it has obtained and submitted to Engineer an inquiry identification number from Underground Services Alert. 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 60 7.14 Trenching and Excavations of Four Feet or More. As required by Public Contract Code § 7104, if the Work includes digging trenches or other excavations that extend deeper than four feet below the surface, the provisions in this Section apply to the Work and the Project. (A) Duty to Notify. Contractor must promptly, and before the following conditions are disturbed, provide written notice to City if Contractor finds any of the following conditions: (1) Material that Contractor believes may be a hazardous waste, as defined in § 25117 of the Health and Safety Code, that is required to be removed to a Class I, Class II, or Class III disposal site in accordance with the provisions of existing Laws; (2) Subsurface or latent physical conditions at the Project site differing from those indicated by information about the Project site made available to bidders prior to the deadline for submitting bids; or (3) Unknown physical conditions at the Project site of any unusual nature, materially different from those ordinarily encountered and generally recognized as inherent in work of the character required by the Contract Documents. (B) City Investigation. City will promptly investigate the conditions and if City finds that the conditions materially differ from those indicated, apparent, or reasonably inferred from information about the Project site made available to bidders, or involve hazardous waste, and cause a decrease or increase in Contractor’s cost of, or the time required for, performance of any part of the Work, City will issue a Change Order. (C) Disputes. In the event that a dispute arises between City and Contractor regarding any of the conditions specified in subsection (B) above, or the terms of a Change Order issued by City, Contractor will not be excused from completing the Work within the Contract Time, but must proceed with all Work to be performed under the Contract. Contractor will retain any and all rights provided either by the Contract or by Laws which pertain to the resolution of disputes between Contractor and City. 7.15 Trenching of Five Feet or More. As required by Labor Code § 6705, if the Contract Price exceeds $25,000 and the Work includes the excavation of any trench or trenches of five feet or more in depth, a detailed plan must be submitted to City for acceptance in advance of the excavation. The detailed plan must show the design of shoring, bracing, sloping, or other provisions to be made for worker protection from the hazard of caving ground during the excavation. If the plan varies from the shoring system standards, it must be prepared by a California registered civil or structural engineer. Use of a shoring, sloping, or protective system less effective than that required by the Construction Safety Orders is prohibited. 7.16 New Utility Connections. Except as otherwise specified, City will pay connection charges and meter costs for new permanent utilities required by the Contract Documents, if any. Contractor must notify City sufficiently in advance of the time needed to request service from each utility provider so that connections and services are initiated in accordance with the Project schedule. 7.17 Lines and Grades. Contractor is required to use any benchmark provided by the Engineer. Unless otherwise specified in the Contract Documents, Contractor must provide all lines and grades required to execute the Work. Contractor must also provide, 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 61 preserve, and replace if necessary, all construction stakes required for the Project. All stakes or marks must be set by a California licensed surveyor or a California registered civil engineer. Contractor must notify the Engineer of any discrepancies found between Contractor’s staking and grading and information provided by the Contract Documents. Upon completion, all Work must conform to the lines, elevations, and grades shown in the Plans, including any changes directed by a Change Order. 7.18 Historic or Archeological Items. (A) Contractor’s Obligations. Contractor must ensure that all persons performing Work at the Project site are required to immediately notify the Project Manager, upon discovery of any potential historic or archeological items, including historic or prehistoric ruins, a burial ground, archaeological or vertebrate paleontological site, including fossilized footprints or other archeological, paleontological or historical feature on the Project site (collectively, “Historic or Archeological Items”). (B) Discovery; Cessation of Work. Upon discovery of any potential Historic or Archeological Items, Work must be stopped within an 85-foot radius of the find and may not resume until authorized in writing by City. If required by City, Contractor must assist in protecting or recovering the Historic or Archeological Items, with any such assistance to be compensated as Extra Work on a time and materials basis under Article 6, Contract Modification. At City’s discretion, a suspension of Work required due to discovery of Historic or Archeological Items may be treated as Excusable Delay pursuant to Article 5, or as a suspension for convenience under Article 13. 7.19 Environmental Control. Contractor must not pollute any drainage course or its tributary inlets with fuels, oils, bitumens, acids, insecticides, herbicides or other harmful materials. Contractor must prevent the release of any hazardous material or hazardous waste into the soil or groundwater, and prevent the unlawful discharge of pollutants into City’s storm drain system and watercourses as required below. Contractor and its Subcontractors must at all times in the performance of the Work comply with all Laws concerning pollution of waterways. (A) Stormwater Permit. Contractor must comply with all applicable conditions of the State Water Resources Control Board National Pollutant Discharge Elimination System General Permit for Waste Discharge Requirements for Discharges of Stormwater Runoff Associated with Construction Activity (“Stormwater Permit”). (B) Contractor’s Obligations. If required for the Work, a copy of the Stormwater Permit is on file in City’s principal administrative offices, and Contractor must comply with it without adjustment of the Contract Price or the Contract Time. Contractor must timely and completely submit required reports and monitoring information required by the conditions of the Stormwater Permit. Contractor also must comply with all other Laws governing discharge of stormwater, including applicable municipal stormwater management programs. 7.20 Noise Control. Contractor must comply with all applicable noise control Laws. Noise control requirements apply to all equipment used for the Work or related to the Work, including trucks, transit mixers or transient equipment that may or may not be owned by Contractor. 7.21 Mined Materials. Pursuant to the Surface Mining and Reclamation Act of 1975, Public Resources Code § 2710 et seq., any purchase of mined materials, such as construction aggregate, sand, gravel, crushed stone, road base, fill materials, and any other mineral materials must originate from a surface mining operation included on the AB 3098 List, 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 62 which is available online at: ftp://ftp.consrv.ca.gov/pub/omr/AB3098%20List/AB3908List.pdf. Article 8 - Payment 8.1 Schedule of Values. Prior to submitting its first application for payment, Contractor must prepare and submit to the Project Manager a schedule of values apportioned to the various divisions and phases of the Work, including mobilization and demobilization. If a Bid Schedule was submitted with Contractor’s bid, the amounts in the schedule of values must be consistent with the Bid Schedule. Each line item contained in the schedule of values must be assigned a value such that the total of all items equals the Contract Price. The items must be sufficiently detailed to enable accurate evaluation of the percentage of completion claimed in each application for payment, and the assigned value consistent with any itemized or unit pricing submitted with Contractor’s bid. (A) Measurements for Unit Price Work. Materials and items of Work to be paid for on the basis of unit pricing will be measured according to the methods specified in the Contract Documents. (B) Deleted or Reduced Work. Contractor will not be compensated for Work that City has deleted or reduced in scope, except for any labor, material or equipment costs for such Work that Contractor reasonably incurred before Contractor learned that the Work could be deleted or reduced. Contractor will only be compensated for those actual, direct and documented costs incurred, and will not be entitled to any mark up for overhead or lost profits. 8.2 Progress Payments. Following the last day of each month, or as otherwise required by the Special Conditions or Specifications, Contractor will submit to the Project Manager a monthly application for payment for Work performed during the preceding month based on the estimated value of the Work performed during that preceding month. (A) Application for Payment. Each application for payment must be itemized to include labor, materials, and equipment incorporated into the Work, and materials and equipment delivered to the Project site, as well as authorized and approved Change Orders. Each payment application must be supported by the unit prices submitted with Contractor’s Bid Schedule and/or schedule of values and any other substantiating data required by the Contract Documents. (B) Payment of Undisputed Amounts. City will pay the undisputed amount due within 30 days after Contractor has submitted a complete and accurate payment application, subject to Public Contract Code § 20104.50. City will deduct a percentage from each progress payment as retention, as set forth in Section 8.5, below, and may withhold additional amounts as set forth in Section 8.3, below. 8.3 Adjustment of Payment Application. City may adjust or reject the amount requested in a payment application, including application for Final Payment, in whole or in part, if the amount requested is disputed or unsubstantiated. Contractor will be notified in writing of the basis for the modification to the amount requested. City may also deduct or withhold from payment otherwise due based upon any of the circumstances and amounts listed below. Sums withheld from payment otherwise due will be released when the basis for that withholding has been remedied and no longer exists. (A) For Contractor’s unexcused failure to perform the Work as required by the Contract Documents, including correction or completion of punch list items, City may 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 63 withhold or deduct an amount based on the City’s estimated cost to correct or complete the Work. (B) For loss or damage caused by Contractor or its Subcontractors arising out of or relating to performance of the Work or any failure to protect the Project site, City may deduct an amount based on the estimated cost to repair or replace. (C) For Contractor’s failure to pay its Subcontractors and suppliers when payment is due, City may withhold an amount equal to the total of past due payments and may opt to pay that amount separately via joint check pursuant to Section 8.6(B), Joint Checks. (D) For Contractor’s failure to timely correct rejected, nonconforming, or defective Work, City may withhold or deduct an amount based on the City’s estimated cost to correct or complete the Work. (E) For any unreleased stop notice, City may withhold 125% of the amount claimed. (F) For Contractor’s failure to submit any required schedule or schedule update in the manner and within the time specified in the Contract Documents, City may withhold an amount equal to five percent of the total amount requested until Contractor complies with its schedule submittal obligations. (G) For Contractor’s failure to maintain or submit as-built documents in the manner and within the time specified in the Contract Documents, City may withhold or deduct an amount based on the City’s cost to prepare the as-builts. (H) For Work performed without Shop Drawings that have been accepted by City, when accepted Shop Drawings are required before proceeding with the Work, City may deduct an amount based on the estimated costs to correct unsatisfactory Work or diminution in value. (I) For fines, payments, or penalties assessed under the Labor Code, City may deduct from payments due to Contractor as required by Laws and as directed by the Division of Labor Standards Enforcement. (J) For any other costs or charges that may be withheld or deducted from payments to Contractor, as provided in the Contract Documents, including liquidated damages, City may withhold or deduct such amounts from payment otherwise due to Contractor. 8.4 Early Occupancy. Neither City’s payment of progress payments nor its partial or full use or occupancy of the Project constitutes acceptance of any part of the Work. 8.5 Retention. City will retain five percent of the full amount due on each progress payment (i.e., the amount due before any withholding or deductions pursuant to Section 8.3, Adjustment to Payment Application), or the percentage stated in the Notice Inviting Bids, whichever is greater, as retention to ensure full and satisfactory performance of the Work. Contractor is not entitled to any reduction in the rate of withholding at any time, nor to release of any retention before 35 days following City’s acceptance of the Project. (A) Substitution of Securities. As provided by Public Contract Code § 22300, Contractor may request in writing that it be allowed, at its sole expense, to substitute securities for the retention withheld by City. Any escrow agreement entered into pursuant to this provision must fully comply with Public Contract Code § 22300 and will be subject to approval as to form by City’s legal counsel. If City exercises its right to draw upon such securities in the event of default pursuant to section (7) of the statutory Escrow Agreement for Security Deposits in Lieu of Retention, pursuant to subdivision (f) of Public 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 64 Contract Code § 22300 (“Escrow Agreement”), and if Contractor disputes that it is in default, its sole remedy is to comply with the dispute resolution procedures in Article 12 and the provisions therein. It is agreed that for purposes of this paragraph, an event of default includes City’s rights pursuant to these Contract Documents to withhold or deduct sums from retention, including withholding or deduction for liquidated damages, incomplete or defective Work, stop payment notices, or backcharges. It is further agreed that if any individual authorized to give or receive written notice on behalf of a party pursuant to section (10) of the Escrow Agreement are unavailable to give or receive notice on behalf of that party due to separation from employment, retirement, death, or other circumstances, the successor or delegee of the named individual is deemed to be the individual authorized to give or receive notice pursuant to section (10) of the Escrow Agreement. (B) Release of Undisputed Retention. All undisputed retention, less any amounts that may be assessed as liquidated damages, retained for stop notices, or otherwise withheld pursuant to Section 8.3, Adjustment of Payment Application, will be released as Final Payment to Contractor no sooner than 35 days following recordation of the notice of completion, and no later than 60 days following acceptance of the Project by City’s governing body or authorized designee pursuant to Section 11.1(C), Acceptance, or, if the Project has not been accepted, no later than 60 days after the Project is otherwise considered complete pursuant to Public Contract Code § 7107(c). 8.6 Payment to Subcontractors and Suppliers. Each month, Contractor must promptly pay each Subcontractor and supplier the value of the portion of labor, materials, and equipment incorporated into the Work or delivered to the Project site by the Subcontractor or supplier during the preceding month. Such payments must be made in accordance with the requirements of Laws pertaining to such payments, and those of the Contract Documents and applicable subcontract or supplier contract. (A) Withholding for Stop Notice. Pursuant to Civil Code § 9358, City will withhold 125% of the amount claimed by an unreleased stop notice, a portion of which may be retained by City for the costs incurred in handling the stop notice claim, including attorneys’ fees and costs, as authorized by law. (B) Joint Checks. City reserves the right, acting in its sole discretion, to issue joint checks made payable to Contractor and a Subcontractor or supplier, if City determines this is necessary to ensure fair and timely payment for a Subcontractor or supplier who has provided services or goods for the Project. As a condition to release of payment by a joint check, the joint check payees may be required to execute a joint check agreement in a form provided or approved by the City Attorney’s Office. The joint check payees will be jointly and severally responsible for the allocation and disbursement of funds paid by joint check. Payment by joint check will not be construed to create a contractual relationship between City and a Subcontractor or supplier of any tier beyond the scope of the joint check agreement. 8.7 Final Payment. Contractor’s application for Final Payment must comply with the requirements for submitting an application for a progress payment as stated in Section 8.2, above. Corrections to previous progress payments, including adjustments to estimated quantities for unit priced items, may be included in the Final Payment. If Contractor fails to submit a timely application for Final Payment, City reserves the right to unilaterally process and issue Final Payment without an application from Contractor in order to close out the Project. For the purposes of determining the deadline for Claim submission pursuant to Article 12, the date of Final Payment is deemed to be the date that City acts to release undisputed retention as final payment to Contractor, or otherwise provides written notice to Contractor of Final Payment or that no undisputed funds remain available for Final Payment due to offsetting withholdings or deductions pursuant to 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 65 Section 8.3, Adjustment of Payment Application. If the amount due from Contractor to City exceeds the amount of Final Payment, City retains the right to recover the balance from Contractor or its sureties. 8.8 Release of Claims. City may, at any time, require that payment of the undisputed portion of any progress payment or Final Payment be contingent upon Contractor furnishing City with a written waiver and release of all claims against City arising from or related to the portion of Work covered by those undisputed amounts subject to the limitations of Public Contract Code § 7100. Any disputed amounts may be specifically excluded from the release. 8.9 Warranty of Title. Contractor warrants that title to all work, materials, or equipment incorporated into the Work and included in a request for payment will pass over to City free of any claims, liens, or encumbrances upon payment to Contractor. Article 9 - Labor Provisions 9.1 Discrimination Prohibited. Discrimination against any prospective or present employee engaged in the Work on grounds of race, color, ancestry, national origin, ethnicity, religion, sex, sexual orientation, age, disability, or marital status is strictly prohibited. Contractor and its Subcontractors are required to comply with all applicable Laws prohibiting discrimination, including the California Fair Employment and Housing Act (Govt. Code § 12900 et seq.), Government Code § 11135, and Labor Code §§ 1735, 1777.5, 1777.6, and 3077.5. 9.2 Labor Code Requirements. (A) Eight Hour Day. Pursuant to Labor Code § 1810, eight hours of labor constitute a legal day’s work under this Contract. (B) Penalty. Pursuant to Labor Code § 1813, Contractor will forfeit to City as a penalty, the sum of $25.00 for each day during which a worker employed by Contractor or any Subcontractor is required or permitted to work more than eight hours in any one calendar day or more than 40 hours per calendar week, except if such workers are paid overtime under Labor Code § 1815. (C) Apprentices. Contractor is responsible for compliance with the requirements governing employment and payment of apprentices, as set forth in Labor Code § 1777.5, which is fully incorporated by reference. (D) Notices. Pursuant to Labor Code § 1771.4, Contractor is required to post all job site notices prescribed by Laws. 9.3 Prevailing Wages. Each worker performing Work under this Contract that is covered under Labor Code §§ 1720 or 1720.9, including cleanup at the Project site, must be paid at a rate not less than the prevailing wage as defined in §§ 1771 and 1774 of the Labor Code. The prevailing wage rates are on file with the City and available online at http://www.dir.ca.gov/dlsr. Contractor must post a copy of the applicable prevailing rates at the Project site. (A) Penalties. Pursuant to Labor Code § 1775, Contractor and any Subcontractor will forfeit to City as a penalty up to $200.00 for each calendar day, or portion a day, for each worker paid less than the applicable prevailing wage rate. Contractor must also pay each worker the difference between the applicable prevailing wage rate and the amount actually paid to that worker. 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 66 (B) Federal Requirements. If this Project is subject to federal prevailing wage requirements in addition to California prevailing wage requirements, Contractor and its Subcontractors are required to pay the higher of the currently applicable state or federal prevailing wage rates. 9.4 Payroll Records. Contractor must comply with the provisions of Labor Code §§ 1776 and 1812 and all implementing regulations, which are fully incorporated by this reference, including requirements for electronic submission of payroll records to the DIR. (A) Contractor and Subcontractor Obligations. Contractor and each Subcontractor must keep accurate payroll records, showing the name, address, social security number, work classification, straight time and overtime hours worked each day and week, and the actual per diem wages paid to each journeyman, apprentice, worker, or other employee employed in connection with the Work. Each payroll record must contain or be verified by a written declaration that it is made under penalty of perjury, stating both of the following: (1) The information contained in the payroll record is true and correct; and (2) Contractor or the Subcontractor has complied with the requirements of Labor Code §§ 1771, 1811, and 1815 for any Work performed by its employees on the Project. (B) Certified Record. A certified copy of an employee’s payroll record must be made available for inspection or furnished to the employee or his or her authorized representative on request, to City, to the Division of Labor Standards Enforcement, to the Division of Apprenticeship Standards of the DIR, and as further required by the Labor Code. (C) Enforcement. Upon notice of noncompliance with Labor Code § 1776, Contractor or Subcontractor has ten days in which to comply with the requirements of this section. If Contractor or Subcontractor fails to do so within the ten-day period, Contractor or Subcontractor will forfeit a penalty of $100.00 per day, or portion a day, for each worker for whom compliance is required, until strict compliance is achieved. Upon request by the Division of Apprenticeship Standards, or the Division of Labor Standards Enforcement, these penalties will be withheld from payments then due to Contractor. 9.5 Labor Compliance. Pursuant to Labor Code § 1771.4, the Contract for this Project is subject to compliance monitoring and enforcement by the DIR. Article 10 - Safety Provisions 10.1 Safety Precautions and Programs. Contractor and its Subcontractors are fully responsible for safety precautions and programs, and for the safety of persons and property in the performance of the Work. Contractor and its Subcontractors must at all times comply with all applicable health and safety Laws and seek to avoid injury, loss, or damage to persons or property by taking reasonable steps to protect its employees and other persons at any Worksite, materials and equipment stored on or off site, and property at or adjacent to any Worksite. (A) Reporting Requirements. Contractor must immediately notify the City of any death, serious injury or illness resulting from Work on the Project. Contractor must immediately provide a written report to City of each recordable accident or injury occurring at any Worksite within 24 hours of the occurrence. The written report must 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 67 include: (1) the name and address of the injured or deceased person; (2) the name and address of each employee of Contractor or of any Subcontractor involved in the incident; (3) a detailed description of the incident, including precise location, time, and names and contact information for known witnesses; and (4) a police or first responder report, if applicable. If Contractor is required to file an accident report with a government agency, Contractor will provide a copy of the report to City. (B) Legal Compliance. Contractor’s safety program must comply with the applicable legal and regulatory requirements. Contractor must provide City with copies of all notices required by Laws. (C) Contractor’s Obligations. Any damage or loss caused by Contractor arising from the Work which is not insured under property insurance must be promptly remedied by Contractor. (D) Remedies. If City determines, in its sole discretion, that any part of the Work or Project site is unsafe, City may, without assuming responsibility for Contractor’s safety program, require Contractor or its Subcontractor to cease performance of the Work or to take corrective measures to City’s satisfaction. If Contractor fails to promptly take the required corrective measures, City may perform them and deduct the cost from the Contract Price. Contractor agrees it is not entitled to submit a Claim for damages, for an increase in Contract Price, or for a change in Contract Time based on Contractor’s compliance with City’s request for corrective measures pursuant to this provision. 10.2 Hazardous Materials. Unless otherwise specified in the Contract Documents, this Contract does not include the removal, handling, or disturbance of any asbestos or other Hazardous Materials. If Contractor encounters materials on the Project site that Contractor reasonably believes to be asbestos or other Hazardous Materials, and the asbestos or other Hazardous Materials have not been rendered harmless, Contractor may continue Work in unaffected areas reasonably believed to be safe, but must immediately cease work on the area affected and report the condition to City. No asbestos, asbestos-containing products or other Hazardous Materials may be used in performance of the Work. 10.3 Material Safety. Contractor is solely responsible for complying with § 5194 of Title 8 of the California Code of Regulations, including by providing information to Contractor’s employees about any hazardous chemicals to which they may be exposed in the course of the Work. A hazard communication program and other forms of warning and training about such exposure must be used. Contractor must also maintain Safety Data Sheets (“SDS”) at the Project site, as required by Laws, for materials or substances used or consumed in the performance of the Work. The SDS will be accessible and available to Contractor’s employees, Subcontractors, and City. (A) Contractor Obligations. Contractor is solely responsible for the proper delivery, handling, use, storage, removal, and disposal of all materials brought to the Project site and/or used in the performance of the Work. Contractor must notify the Engineer if a specified product or material cannot be used safely. (B) Labeling. Contractor must ensure proper labeling on any material brought onto the Project site so that any persons working with or in the vicinity of the material may be informed as to the identity of the material, any potential hazards, and requirements for proper handling, protections, and disposal. 10.4 Hazardous Condition. Contractor is solely responsible for determining whether a hazardous condition exists or is created during the course of the Work, involving a risk of bodily harm to any person or risk of damage to any property. If a hazardous condition 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 68 exists or is created, Contractor must take all precautions necessary to address the condition and ensure that the Work progresses safely under the circumstances. Hazardous conditions may result from, but are not limited to, use of specified materials or equipment, the Work location, the Project site condition, the method of construction, or the way any Work must be performed. 10.5 Emergencies. In an emergency affecting the safety or protection of persons, Work, or property at or adjacent to any Worksite, Contractor must take reasonable and prompt actions to prevent damage, injury, or loss, without prior authorization from the City if, under the circumstances, there is inadequate time to seek prior authorization from the City. Article 11 - Completion and Warranty Provisions 11.1 Final Completion. (A) Final Inspection and Punch List. When the Work required by this Contract is fully performed, Contractor must provide written notification to City requesting final inspection. The Engineer will schedule the date and time for final inspection, which must include Contractor’s primary representative for this Project and its superintendent. Based on that inspection, City will prepare a punch list of any items that are incomplete, missing, defective, incorrectly installed, or otherwise not compliant with the Contract Documents. The punch list to Contractor will specify the time by which all of the punch list items must be completed or corrected. The punch list may include City’s estimated cost to complete each punch list item if Contractor fails to do so within the specified time. The omission of any non-compliant item from a punch list will not relieve Contractor from fulfilling all requirements of the Contract Documents. Contractor’s failure to complete any punch list item within the time specified in the punch list will not waive or abridge its warranty obligations for any such items that must be completed by the City or by a third party retained by the City due to Contractor’s failure to timely complete any such outstanding item. (B) Requirements for Final Completion. Final Completion will be achieved upon completion or correction of all punch list items, as verified by City’s further inspection, and upon satisfaction of all other Contract requirements, including any commissioning required under the Contract Documents and submission of all final submittals, including instructions and manuals as required under Section 7.10, and complete, final as-built drawings as required under Section 7.11, all to City’s satisfaction. (C) Acceptance. The Project will be considered accepted upon City Council action during a public meeting to accept the Project, unless the Engineer is authorized to accept the Project, in which case the Project will be considered accepted upon the date of the Engineer’s issuance of a written notice of acceptance. In order to avoid delay of Project close out, the City may elect, acting in its sole discretion, to accept the Project as complete subject to exceptions for punch list items that are not completed within the time specified in the punch list. (D) Final Payment and Release of Retention. Final Payment and release of retention, less any sums withheld pursuant to the provisions of the Contract Documents, will not be made sooner than 35 days after recordation of the notice of completion. If Contractor fails to complete all of the punch list items within the specified time, City may withhold up to 150% of City’s estimated cost to complete each of the remaining items from Final Payment and may use the withheld retention to pay for the costs to self- perform the outstanding items or to retain a third party to complete any such outstanding punch list item. 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 69 11.2 Warranty. (A) General. Contractor warrants that all materials and equipment will be new unless otherwise specified, of good quality, in conformance with the Contract Documents, and free from defective workmanship and materials. Contractor further warrants that the Work will be free from material defects not intrinsic in the design or materials required in the Contract Documents. Contractor warrants that materials or items incorporated into the Work comply with the requirements and standards in the Contract Documents, including compliance with Laws, and that any Hazardous Materials encountered or used were handled as required by Laws. At City’s request, Contractor must furnish satisfactory evidence of the quality and type of materials and equipment furnished. Contractor’s warranty does not extend to damage caused by normal wear and tear, or improper use or maintenance. (B) Warranty Period. Contractor’s warranty must guarantee its Work for a period of one year from the date of Project acceptance (the “Warranty Period”), except when a longer guarantee is provided by a supplier or manufacturer or is required by the Specifications or Special Conditions. Contractor must obtain from its Subcontractors, suppliers and manufacturers any special or extended warranties required by the Contract Documents. (C) Warranty Documents. As a condition precedent to Final Completion, Contractor must supply City with all warranty and guarantee documents relevant to equipment and materials incorporated into the Work and guaranteed by their suppliers or manufacturers. (D) Subcontractors. The warranty obligations in the Contract Documents apply to Work performed by Contractor and its Subcontractors, and Contractor agrees to be co- guarantor of such Work. (E) Contractor’s Obligations. Upon written notice from City to Contractor of any defect in the Work discovered during the Warranty Period, Contractor or its responsible Subcontractor must promptly correct the defective Work at its own cost. Contractor’s obligation to correct defects discovered during the Warranty Period will continue past the expiration of the Warranty Period as to any defects in Work for which Contractor was notified prior to expiration of the Warranty Period. Work performed during the Warranty Period (“Warranty Work”) will be subject to the warranty provisions in this Section 11.2 for a one-year period that begins upon completion of such Warranty Work to City’s satisfaction. (F) City’s Remedies. If Contractor or its responsible Subcontractor fails to correct defective Work within ten days following notice by City, or sooner if required by the circumstances, City may correct the defects to conform with the Contract Documents at Contractor’s sole expense. Contractor must reimburse City for its costs in accordance with subsection (H), below. (G) Emergency Repairs. In cases of emergency where any delay in correcting defective Work could cause harm, loss or damage, City may immediately correct the defects to conform with the Contract Documents at Contractor’s sole expense. Contractor or its surety must reimburse City for its costs in accordance with subsection (H), below. (H) Reimbursement. Contractor must reimburse City for its costs to repair under subsections (F) or (G), above, within 30 days following City’s submission of a demand for payment pursuant to this provision. If City is required to initiate legal action to compel Contractor’s compliance with this provision, and City is the prevailing party in such action, 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 70 Contractor and its surety are solely responsible for all of City’s attorney’s fees and legal costs expended to enforce Contractor’s warranty obligations herein in addition to any and all costs City incurs to correct the defective Work. 11.3 Use Prior to Final Completion. City reserves the right to occupy or make use of the Project, or any portions of the Project, prior to Final Completion if City has determined that the Project or portion of it is in a condition suitable for the proposed occupation or use, and that it is in its best interest to occupy or make use of the Project, or any portions of it, prior to Final Completion. City will notify Contractor in writing of its intent to occupy or make use of the Project or any portions of the Project, pursuant to this provision. (A) Non-Waiver. Occupation or use of the Project, in whole or in part, prior to Final Completion will not operate as acceptance of the Work or any portion of it, nor will it operate as a waiver of any of City’s rights or Contractor’s duties pursuant to these Contract Documents, and will not affect nor bear on the determination of the time of substantial completion with respect to any statute of repose pertaining to the time for filing an action for construction defect. (B) City’s Responsibility. City will be responsible for the cost of maintenance and repairs due to normal wear and tear with respect to those portions of the Project that are being occupied or used before Final Completion. The Contract Price or the Contract Time may be adjusted pursuant to the applicable provisions of these Contract Documents if, and only to the extent that, any occupation or use under this Section actually adds to Contractor’s cost or time to complete the Work within the Contract Time. 11.4 Substantial Completion. For purposes of determining “substantial completion” with respect to any statute of repose pertaining to the time for filing an action for construction defect, “substantial completion” is deemed to mean the last date that Contractor or any Subcontractor performs Work on the Project prior to City acceptance of the Project, except for warranty work performed under this Article. Article 12 - Dispute Resolution 12.1 Claims. This Article applies to and provides the exclusive procedures for any Claim arising from or related to the Contract or performance of the Work. (A) Definition. “Claim” means a separate demand by Contractor, submitted in writing by registered or certified mail with return receipt requested, for a change in the Contract Time, including a time extension or relief from liquidated damages, or a change in the Contract Price, when the demand has previously been submitted to City in accordance with the requirements of the Contract Documents, and which has been rejected or disputed by City, in whole or in part. A Claim may also include that portion of a unilateral Change Order that is disputed by the Contractor. (B) Limitations. A Claim may only include the portion of a previously rejected demand that remains in dispute between Contractor and City. With the exception of any dispute regarding the amount of money actually paid to Contractor as Final Payment, Contractor is not entitled to submit a Claim demanding a change in the Contract Time or the Contract Price, which has not previously been submitted to City in full compliance with Article 5 and Article 6, and subsequently rejected in whole or in part by City. (C) Scope of Article. This Article is intended to provide the exclusive procedures for submission and resolution of Claims of any amount and applies in addition to the provisions of Public Contract Code § 9204 and § 20104 et seq., which are incorporated by reference herein. 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 71 (D) No Work Delay. Notwithstanding the submission of a Claim or any other dispute between the parties related to the Project or the Contract Documents, Contractor must perform the Work and may not delay or cease Work pending resolution of a Claim or other dispute, but must continue to diligently prosecute the performance and timely completion of the Work, including the Work pertaining to the Claim or other dispute. (E) Informal Resolution. Contractor will make a good faith effort to informally resolve a dispute before initiating a Claim, preferably by face-to-face meeting between authorized representatives of Contractor and City. 12.2 Claims Submission. The following requirements apply to any Claim subject to this Article: (A) Substantiation. The Claim must be submitted to City in writing, clearly identified as a “Claim” submitted pursuant to this Article 12 and must include all of the documents necessary to substantiate the Claim including the Change Order request that was rejected in whole or in part, and a copy of City’s written rejection that is in dispute. The Claim must clearly identify and describe the dispute, including relevant references to applicable portions of the Contract Documents, and a chronology of relevant events. Any Claim for additional payment must include a complete, itemized breakdown of all known or estimated labor, materials, taxes, insurance, and subcontract, or other costs. Substantiating documentation such as payroll records, receipts, invoices, or the like, must be submitted in support of each component of claimed cost. Any Claim for an extension of time or delay costs must be substantiated with a schedule analysis and narrative depicting and explaining claimed time impacts. (B) Claim Format and Content. A Claim must be submitted in the following format: (1) Provide a cover letter, specifically identifying the submission as a “Claim” submitted under this Article 12 and specifying the requested remedy (e.g., amount of proposed change to Contract Price and/or change to Contract Time). (2) Provide a summary of each Claim, including underlying facts and the basis for entitlement, and identify each specific demand at issue, including the specific Change Order request (by number and submittal date), and the date of City's rejection of that demand, in whole or in part. (3) Provide a detailed explanation of each issue in dispute. For multiple issues included within a single Claim or for multiple Claims submitted concurrently, separately number and identify each individual issue or Claim, and include the following for each separate issue or Claim: a. A succinct statement of the matter in dispute, including Contractor’s position and the basis for that position; b. Identify and attach all documents that substantiate the Claim, including relevant provisions of the Contract Documents, RFIs, calculations, and schedule analysis (see subsection (A), Substantiation, above); c. A chronology of relevant events; and d. Analysis and basis for claimed changes to Contract Price, Contract Time, or any other remedy requested. 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 72 (4) Provide a summary of issues and corresponding claimed damages. If, by the time of the Claim submission deadline (below), the precise amount of the requested change in the Contract Price or Contract Time is not yet known, Contractor must provide a good faith estimate, including the basis for that estimate, and must identify the date by which it is anticipated that the Claim will be updated to provide final amounts. (5) Include the following certification, executed by Contractor’s authorized representative: “The undersigned Contractor certifies under penalty of perjury that its statements and representations in this Claim submittal are true and correct. Contractor warrants that this Claim submittal is comprehensive and complete as to the matters in dispute, and agrees that any costs, expenses, or delay not included herein are deemed waived.” (C) Submission Deadlines. (1) A Claim disputing rejection of a request for a change in the Contract Time or Contract Price must be submitted within 15 days following the date that City notified Contractor in writing that a request for a change in the Contract Time or Contract Price, duly submitted in compliance with Article 5 and Article 6, has been rejected in whole or in part. A Claim disputing the terms of a unilateral Change Order must be submitted within 15 days following the date of issuance of the unilateral Change Order. These Claim deadlines apply even if Contractor cannot yet quantify the total amount of any requested change in the Contract Time or Contract Price. If the Contractor cannot quantify those amounts, it must submit an estimate of the amounts claimed pending final determination of the requested remedy by Contractor. (2) With the exception of any dispute regarding the amount of Final Payment, any Claim must be filed on or before the date of Final Payment or will be deemed waived. (3) A Claim disputing the amount of Final Payment must be submitted within 15 days of the effective date of Final Payment, under Section 8.7, Final Payment. (4) Strict compliance with these Claim submission deadlines is necessary to ensure that any dispute may be mitigated as soon as possible, and to facilitate cost-efficient administration of the Project. Any Claim that is not submitted within the specified deadlines will be deemed waived by Contractor. 12.3 City’s Response. City will respond within 45 days of receipt of the Claim with a written statement identifying which portion(s) of the Claim are disputed, unless the 45-day period is extended by mutual agreement of City and Contractor or as otherwise allowed under Public Contract Code § 9204. However, if City determines that the Claim is not adequately substantiated pursuant to Section 12.2(A), Substantiation, City may first request in writing, within 30 days of receipt of the Claim, any additional documentation supporting the Claim or relating to defenses to the Claim that City may have against the Claim. (A) Additional Information. If additional information is thereafter required, it may be requested and provided upon mutual agreement of City and Contractor. If Contractor’s Claim is based on estimated amounts, Contractor has a continuing duty to update its Claim as soon as possible with information on actual amounts in order to facilitate prompt and fair resolution of the Claim. 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 73 (B) Non-Waiver. Any failure by City to respond within the times specified above will not be construed as acceptance of the Claim, in whole or in part, or as a waiver of any provision of these Contract Documents. 12.4 Meet and Confer. If Contractor disputes City’s written response, or City fails to respond within the specified time, within 15 days of receipt of City’s response or within 15 days of City’s failure to respond within the applicable 45-day time period under Section 12.3, respectively, Contractor may notify City of the dispute in writing sent by registered or certified mail, return receipt requested, and demand an informal conference to meet and confer for settlement of the issues in dispute. If Contractor fails to dispute City’s response in writing within the specified time, Contractor’s Claim will be deemed waived. (A) Schedule Meet and Confer. Upon receipt of the demand to meet and confer, City will schedule the meet and confer conference to be held within 30 days, or later if needed to ensure the mutual availability of each of the individuals that each party requires to represent its interests at the meet and confer conference. (B) Location for Meet and Confer. The meet and confer conference will be scheduled at a location at or near City’s principal office. (C) Written Statement After Meet and Confer. Within ten working days after the meet and confer has concluded, City will issue a written statement identifying which portion(s) of the Claim remain in dispute, if any. (D) Submission to Mediation. If the Claim or any portion remains in dispute following the meet and confer conference, within ten working days after the City issues the written statement identifying any portion(s) of the Claim remaining in dispute, the Contractor may identify in writing disputed portion(s) of the Claim, which will be submitted for mediation, as set forth below. 12.5 Mediation and Government Code Claims. (A) Mediation. Within ten working days after the City issues the written statement identifying any portion(s) of the Claim remaining in dispute following the meet and confer, City and Contractor will mutually agree to a mediator, as provided under Public Contract Code § 9204. Mediation will be scheduled to ensure the mutual availability of the selected mediator and all of the individuals that each party requires to represent its interests. If there are multiple Claims in dispute, the parties may agree to schedule the mediation to address all outstanding Claims at the same time. The parties will share the costs of the mediator and mediation fees equally, but each party is otherwise solely and separately responsible for its own costs to prepare for and participate in the mediation, including costs for its legal counsel or any other consultants. (B) Government Code Claims. (1) Timely presentation of a Government Code Claim is a condition precedent to filing any legal action based on or arising from the Contract. Compliance with the Claim submission requirements in this Article 12 is a condition precedent to filing a Government Code Claim. (2) The time for filing a Government Code Claim will be tolled from the time Contractor submits its written Claim pursuant to Section 12.2, above, until the time that Claim is denied in whole or in part at the conclusion of the meet and confer process, including any period of time used by the meet and confer process. However, if the Claim is submitted to mediation, the time for filing a 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 74 Government Code Claim will be tolled until conclusion of the mediation, including any continuations, if the Claim is not fully resolved by mutual agreement of the parties during the mediation or any continuation of the mediation. 12.6 Tort Claims. This Article does not apply to tort claims and nothing in this Article is intended nor will be construed to change the time periods for filing tort-based Government Code Claims. 12.7 Arbitration. It is expressly agreed, under Code of Civil Procedure § 1296, that in any arbitration to resolve a dispute relating to this Contract, the arbitrator’s award must be supported by law and substantial evidence. 12.8 Burden of Proof and Limitations. Contractor bears the burden of proving entitlement to and the amount of any claimed damages. Contractor is not entitled to damages calculated on a total cost basis, but must prove actual damages. Contractor is not entitled to speculative, special, or consequential damages, including home office overhead or any form of overhead not directly incurred at the Project site or any other Worksite; lost profits; loss of productivity; lost opportunity to work on other projects; diminished bonding capacity; increased cost of financing for the Project; extended capital costs; non- availability of labor, material or equipment due to delays; or any other indirect loss arising from the Contract. The Eichleay Formula or similar formula will not be used for any recovery under the Contract. The City will not be directly liable to any Subcontractor or supplier. 12.9 Legal Proceedings. In any legal proceeding that involves enforcement of any requirements of the Contract Documents, the finder of fact will receive detailed instructions on the meaning and operation of the Contract Documents, including conditions, limitations of liability, remedies, claim procedures, and other provisions bearing on the defenses and theories of liability. Detailed findings of fact will be requested to verify enforcement of the Contract Documents. All of the City's remedies under the Contract Documents will be construed as cumulative, and not exclusive, and the City reserves all rights to all remedies available under law or equity as to any dispute arising from or relating to the Contract Documents or performance of the Work. 12.10 Other Disputes. The procedures in this Article 12 will apply to any and all disputes or legal actions, in addition to Claims, arising from or related to this Contract, including disputes regarding suspension or early termination of the Contract, unless and only to the extent that compliance with a procedural requirement is expressly and specifically waived by City. Nothing in this Article is intended to delay suspension or termination under Article 13. Article 13 - Suspension and Termination 13.1 Suspension for Cause. In addition to all other remedies available to City, if Contractor fails to perform or correct Work in accordance with the Contract Documents, including non-compliance with applicable environmental or health and safety Laws, City may immediately order the Work, or any portion of it, suspended until the circumstances giving rise to the suspension have been eliminated to City’s satisfaction. (A) Notice of Suspension. Upon receipt of City’s written notice to suspend the Work, in whole or in part, except as otherwise specified in the notice of suspension, Contractor and its Subcontractors must promptly stop Work as specified in the notice of suspension; comply with directions for cleaning and securing the Worksite; and protect the completed and in-progress Work and materials. Contractor is solely responsible for 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 75 any damages or loss resulting from its failure to adequately secure and protect the Project. (B) Resumption of Work. Upon receipt of the City’s written notice to resume the suspended Work, in whole or in part, except as otherwise specified in the notice to resume, Contractor and its Subcontractors must promptly re-mobilize and resume the Work as specified; and within ten days from the date of the notice to resume, Contractor must submit a recovery schedule, prepared in accordance with the Contract Documents, showing how Contractor will complete the Work within the Contract Time. (C) Failure to Comply. Contractor will not be entitled to an increase in the Contract Time or Contract Price for a suspension occasioned by Contractor’s failure to comply with the Contract Documents. (D) No Duty to Suspend. City’s right to suspend the Work will not give rise to a duty to suspend the Work, and City’s failure to suspend the Work will not constitute a defense to Contractor’s failure to comply with the requirements of the Contract Documents. 13.2 Suspension for Convenience. City reserves the right to suspend, delay, or interrupt the performance of the Work in whole or in part, for a period of time determined to be appropriate for City’s convenience. Upon notice by City pursuant to this provision, Contractor must immediately suspend, delay, or interrupt the Work and secure the Project site as directed by City except for taking measures to protect completed or in- progress Work as directed in the suspension notice, and subject to the provisions of Section 13.1(A) and (B), above. If Contractor submits a timely request for a Change Order in compliance with Articles 5 and 6, the Contract Price and the Contract Time will be equitably adjusted by Change Order pursuant to the terms of Articles 5 and 6 to reflect the cost and delay impact occasioned by such suspension for convenience, except to the extent that any such impacts were caused by Contractor’s failure to comply with the Contract Documents or the terms of the suspension notice or notice to resume. However, the Contract Time will only be extended if the suspension causes or will cause unavoidable delay in Final Completion. If Contractor disputes the terms of a Change Order issued for such equitable adjustment due to suspension for convenience, its sole recourse is to comply with the Claim procedures in Article 12. 13.3 Termination for Default. City may declare that Contractor is in default of the Contract for a material breach of or inability to fully, promptly, or satisfactorily perform its obligations under the Contract. (A) Default. Events giving rise to a declaration of default include Contractor’s refusal or failure to supply sufficient skilled workers, proper materials, or equipment to perform the Work within the Contract Time; Contractor’s refusal or failure to make prompt payment to its employees, Subcontractors, or suppliers or to correct defective Work or damage; Contractor’s failure to comply with Laws, or orders of any public agency with jurisdiction over the Project; evidence of Contractor’s bankruptcy, insolvency, or lack of financial capacity to complete the Work as required within the Contract Time; suspension, revocation, or expiration and nonrenewal of Contractor’s license or DIR registration; dissolution, liquidation, reorganization, or other major change in Contractor’s organization, ownership, structure, or existence as a business entity; unauthorized assignment of Contractor’s rights or duties under the Contract; or any material breach of the Contract requirements. (B) Notice of Default and Opportunity to Cure. Upon City’s declaration that Contractor is in default due to a material breach of the Contract Documents, if City determines that the default is curable, City will afford Contractor the opportunity to cure 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 76 the default within ten days of City’s notice of default, or within a period of time reasonably necessary for such cure, including a shorter period of time if applicable. (C) Termination. If Contractor fails to cure the default or fails to expediently take steps reasonably calculated to cure the default within the time period specified in the notice of default, City may issue written notice to Contractor and its performance bond surety of City’s termination of the Contract for default. (D) Waiver. Time being of the essence in the performance of the Work, if Contractor’s surety fails to arrange for completion of the Work in accordance with the Performance Bond within seven calendar days from the date of the notice of termination pursuant to paragraph (C), City may immediately make arrangements for the completion of the Work through use of its own forces, by hiring a replacement contractor, or by any other means that City determines advisable under the circumstances. Contractor and its surety will be jointly and severally liable for any additional cost incurred by City to complete the Work following termination, where “additional cost” means all cost in excess of the cost City would have incurred if Contactor had timely completed Work without the default and termination. In addition, City will have the right to immediate possession and use of any materials, supplies, and equipment procured for the Project and located at the Project site or any Worksite on City property for the purposes of completing the remaining Work. (E) Compensation. Within 30 days of receipt of updated as-builts, all warranties, manuals, instructions, or other required documents for Work installed to date, and delivery to City of all equipment and materials for the Project for which Contractor has already been compensated, Contractor will be compensated for the Work satisfactorily performed in compliance with the Contract Documents up to the effective date of the termination pursuant to the terms of Article 8, Payment, subject to City’s rights to withhold or deduct sums from payment otherwise due pursuant to Section 8.3, and excluding any costs Contractor incurs as a result of the termination, including any cancellation or restocking charges or fees due to third parties. If Contractor disputes the amount of compensation determined by City, its sole recourse is to comply with the Claim Procedures in Article 12, by submitting a Claim no later than 30 days following notice from City of the total compensation to be paid by City. (F) Wrongful Termination. If Contractor disputes the termination, its sole recourse is to comply with the Claim procedures in Article 12. If a court of competent jurisdiction or an arbitrator later determines that the termination for default was wrongful, the termination will be deemed to be a termination for convenience, and Contractor’s damages will be strictly limited to the compensation provided for termination for convenience under Section 13.4, below. Contractor waives any claim for any other damages for wrongful termination including special or consequential damages, lost opportunity costs, or lost profits, and any award of damages is subject to Section 12.8, Burden of Proof and Limitations. 13.4 Termination for Convenience. City reserves the right, acting in its sole discretion, to terminate all or part of the Contract for convenience upon written notice to Contractor. (A) Compensation to Contractor. In the event of City’s termination for convenience, Contractor waives any claim for damages, including for loss of anticipated profits from the Project. The following will constitute full and fair compensation to Contractor, and Contractor will not be entitled to any additional claim or compensation: (1) Completed Work. The value of its Work satisfactorily performed as of the date notice of termination is received, based on Contractor’s schedule of values 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 77 and unpaid costs for items delivered to the Project site that were fabricated for incorporation in the Work; (2) Demobilization. Demobilization costs specified in the schedule of values, or if demobilizations cost were not provided in a schedule of values pursuant to Section 8.1, then based on actual, reasonable, and fully documented demobilization costs; and (3) Termination Markup. Five percent of the total value of the Work performed as of the date of notice of termination, including reasonable, actual, and documented costs to comply with the direction in the notice of termination for convenience, and demobilization costs, which is deemed to cover all overhead and profit to date. (B) Disputes. If Contractor disputes the amount of compensation determined by City pursuant to paragraph (A), above, its sole recourse is to comply with the Claim procedures in Article 12, by submitting a Claim no later than 30 days following notice from City of total compensation to be paid by City. 13.5 Actions Upon Termination for Default or Convenience. The following provisions apply to any termination under this Article, whether for default or convenience, and whether in whole or in part. (A) General. Upon termination City may immediately enter upon and take possession of the Project and the Work and all tools, equipment, appliances, materials, and supplies procured or fabricated for the Project. Contractor will transfer title to and deliver all completed Work and all Work in progress to City. (B) Submittals. Unless otherwise specified in the notice of termination, Contractor must immediately submit to City all designs, drawings, as-built drawings, Project records, contracts with vendors and Subcontractors, manufacturer warranties, manuals, and other such submittals or Work-related documents required under the terms of the Contract Documents, including incomplete documents or drafts. (C) Close Out Requirements. Except as otherwise specified in the notice of termination, Contractor must comply with all of the following: (1) Immediately stop the Work, except for any Work that must be completed pursuant to the notice of termination and comply with City’s instructions for cessation of labor and securing the Project and any other Worksite(s). (2) Comply with City’s instructions to protect the completed Work and materials, using best efforts to minimize further costs. (3) Contractor must not place further orders or enter into new subcontracts for materials, equipment, services or facilities, except as may be necessary to complete any portion of the Work that is not terminated. (4) As directed in the notice, Contractor must assign to City or cancel existing subcontracts that relate to performance of the terminated Work, subject to any prior rights, if any, of the surety for Contractor’s performance bond, and settle all outstanding liabilities and claims, subject to City’s approval. (5) As directed in the notice, Contractor must use its best efforts to sell any materials, supplies, or equipment intended solely for the terminated Work in a manner and at market rate prices acceptable to City. 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 78 (D) Payment Upon Termination. Upon completion of all termination obligations, as specified herein and in the notice of termination, Contractor will submit its request for Final Payment, including any amounts due following termination pursuant to this Article 13. Payment will be made in accordance to the provisions of Article 8, based on the portion of the Work satisfactorily completed, including the close out requirements, and consistent with the previously submitted schedule of values and unit pricing, including demobilization costs. Adjustments to Final Payment may include deductions for the cost of materials, supplies, or equipment retained by Contractor; payments received for sale of any such materials, supplies, or equipment, less re-stocking fees charged; and as otherwise specified in Section 8.3, Adjustment of Payment Application. (E) Continuing Obligations. Regardless of any Contract termination, Contractor’s obligations for portions of the Work already performed will continue and the provisions of the Contract Documents will remain in effect as to any claim, indemnity obligation, warranties, guarantees, submittals of as-built drawings, instructions, or manuals, record maintenance, or other such rights and obligations arising prior to the termination date. Article 14 - Miscellaneous Provisions 14.1 Assignment of Unfair Business Practice Claims. Under Public Contract Code § 7103.5, Contractor and its Subcontractors agree to assign to City all rights, title, and interest in and to all causes of action it may have under section 4 of the Clayton Act (15 U.S.C. § 15) or under the Cartwright Act (Chapter 2 (commencing with § 16700) of Part 2 of Division 7 of the Business and Professions Code), arising from purchases of goods, services, or materials pursuant to the Contract or any subcontract. This assignment will be effective at the time City tenders Final Payment to Contractor, without further acknowledgement by the parties. 14.2 Provisions Deemed Inserted. Every provision of law required to be inserted in the Contract Documents is deemed to be inserted, and the Contract Documents will be construed and enforced as though such provision has been included. If it is discovered that through mistake or otherwise that any required provision was not inserted, or not correctly inserted, the Contract Documents will be deemed amended accordingly. 14.3 Waiver. City’s waiver of a breach, failure of any condition, or any right or remedy contained in or granted by the provisions of the Contract Documents will not be effective unless it is in writing and signed by City. City’s waiver of any breach, failure, right, or remedy will not be deemed a waiver of any other breach, failure, right, or remedy, whether or not similar, nor will any waiver constitute a continuing waiver unless specified in writing by City. 14.4 Titles, Headings, and Groupings. The titles and headings used and the groupings of provisions in the Contract Documents are for convenience only and may not be used in the construction or interpretation of the Contract Documents or relied upon for any other purpose. 14.5 Statutory and Regulatory References. With respect to any amendments to any statutes or regulations referenced in these Contract Documents, the reference is deemed to be the version in effect on the date that that bids were due. 14.6 Survival. The provisions that survive termination or expiration of this Contract include Contract Section 11, Notice, and subsections 12.1, 12.2, 12.3, 12.4, 12.5, and 12.6, of Section 12, General Provisions; and the following provisions in these General Conditions: Section 2.2(J), Contractor’s Records, Section 2.3(C), Termination, Section 3.7, 2023 Concrete Reconstruction Project 2021 Form GENERAL CONDITIONS 2023-104 Page 79 Ownership, Section 4.2, Indemnity, Article 12, Dispute Resolution, and Section 11.2, Warranty. END OF GENERAL CONDITIONS 2023 Concrete Reconstruction Project SPECIAL CONDITIONS 2023-104 Page 80 Special Conditions 1. Authorized Work Days and Hours. Work hours and noise pose a special concern for projects in residential neighborhoods. The City if very concerned for its residents and will diligently enforce the restrictions below. 1.1 Authorized Work Days. Except as expressly authorized in writing by City, Contractor is limited to performing Work on the Project on the following days of the week, excluding holidays observed by City: Monday through Friday 1.2 Authorized Work Hours. Except as expressly authorized in writing by City, Contractor is limited to performing Work on the Project during the following hours: 7:00 a.m – 5:00 p.m local times, weekdays (local roads), 9:30 a.m – 3:30 p.m local times, weekdays (arterial and collector streets). 9:00 a.m – 4:00 p.m. Saturdays and Sundays. a. Equipment and Material Delivery and Off-Haul Hours. No equipment or material may be delivered or off-hauled except between the hours of 7:00 a.m. and 5:00 p.m. No equipment that has a safety back up beeper may be operated before 7:00 a.m. on any day. Note that section 11.32 of the Cupertino Municipal Code prohibits trucks that weigh greater than tree tons from operating within 500’ of a school between the hours of 7:00 AM and 9:30 AM or 2 PM to 4 PM. b. Work Days Only. Work will only be performed on Work Days, as defined in the General Conditions, unless Contractor requests otherwise from City in writing at least 2 working days in advance, and City approves the request in its sole discretion. In the case of Work by Contractor after normal working hours 2. Insurance Requirements. The insurance requirements under Section 4.3 of the General Conditions are modified for this Contract, as set forth below. Except as expressly stated below, all other provisions in Section 4.3 are unchanged and remain in full force and effect. 2.1 Pollution Liability Insurance Waived. The pollution liability insurance policy requirement set forth in subsection 4.3(A)(4) of the General Conditions is hereby waived and does not apply to this Contract. 2.2 Builders Risk Insurance Waived. The builder’s risk insurance policy requirement set forth in subsection 4.3(A)(5) of the General Conditions is hereby waived and does not apply to this Contract. 3. Pre-Construction Conference. City will designate a date and time for a pre- construction conference with Contractor following Contract execution. Project administration procedures and coordination between City and Contractor will be discussed, and Contractor must present City with the following information or documents at the meeting for City’s review and acceptance before the Work commences: 3.1 Name, 24-hour contact information, and qualifications of the proposed on-site superintendent; 3.2 List of all key Project personnel and their complete contact information, including email addresses and telephone numbers during regular hours and after hours; 3.3 Submittals and Traffic Control Plans; 2023 Concrete Reconstruction Project SPECIAL CONDITIONS 2023-104 Page 81 4. Lines and Grades Verification All Work must be done to the lines, grades, and elevations indicated on the Plans and Specifications, and in accordance with all applicable codes and laws. Contractor is required to verify forms and other work comply with lines, grades and elevations. Prior to pouring or placing any concrete or asphalt Contractor must have a California licensed land surveyor or civil engineer field verify lines, grades and elevations prior to proceeding with the placement of concrete or asphalt. The land surveyor or civil engineer must have at least five years of relevant experience, and must be acceptable to the City. Contractor must provide City verification of the licensing and experience for each proposed land surveyor or civil engineer. Contractor must provide City with inspection results for form and grade work. Contractor must remedy any non-compliant Work at no additional cost to City. 5. Construction and Demolition Debris Management Plan A completed construction and demolition (C&D) Debris Management Plan must be submitted using the City’s Green Halo on-line application. All debris disposal and recycling from the construction project must be tracked throughout the duration of the project. The contractor must use Green Halo cupertino.wastetracking.com to create their Plan and to submit all construction waste generation tonnage information. No additional compensation will be paid for implementation of the Debris Management Plan and failure to meet all plan requirements may result in work stoppage, fines, and/or backcharges. For additional information, visit www.cupertino.org/greendev 6. Notification of Residents, Schools and Businesses The Contractor shall be responsible for the following: If t hese notifications are not strictly followed, the Contractor shall not be allowed to w ork on the street. Advance Notice of Work to Abutting Properties The Contractor shall notify the abutting properties along the street where the work is to be completed. Notification to properties shall be in the form of door hangers. The Contractor shall submit a sample door hanger to the City of Cupertino for review and approval prior to placement. Door hangers must be placed 2 working days prior to starting construction on a particular street. The Contractor shall provide the City with the schedule for placement of the door hangers, so that the City can verify that they have been placed within the required notification time. Door hangers must be place by noon so that the City may verify placement. Posting & Towing The Contractor shall be responsible for providing and posting 'No Parking' signs at approximately 100 ft. intervals throughout the section of work. The Contractor shall be responsible for removal of vehicles which would interfere with the work and insure 48 hours notice is given to the property owner or tenant. If these notification procedures are not strictly followed, the Contractor shall not be allowed to work on the street. Towing Procedure Cupertino Municipal Code Section 11.24.200 D authorizes the tow away of vehicle parked on a public street where construction or street repair work is scheduled to occur. The Contractor performing the scheduled work is responsible for erecting the required signs giving notice that such vehicles may be towed away if left on the street 2023 Concrete Reconstruction Project SPECIAL CONDITIONS 2023-104 Page 82 during the time that the work is scheduled to be performed. The signs shall be erected at least 48 hrs. prior to the scheduled start of work. The Contractor must notify Cupertino Code Enforcement (408) 777-3182 with locations of posting, to verify forty-eight (48) hour notice. All costs for notification and posting of signs shall be included in the various items of work and no special compensation will be allowed. SAMPLE NOTICE: NOTICE TO RESIDENTS / BUSINESS OWNERS Date: [MONTH] [DAY], [YEAR] Subject: [NAME OF PROJECT] – [One Week OR Two Day] Notice This notice is to inform you that the City of Cupertino, Department of Public Works, has contracted with [CONTRACTOR NAME] to [SCOPE OF WORK] along [STREET NAME] from [ADJACENT CROSS STREET] to [ADJACENT CROSS STREET]. This [SCOPE OF WORK] will mainly occur on [WEEKDAYS, SEE “SCHEDULE OFWORKING DAYS/HOURS”] from [START TIME] to [END TIME] and is scheduled to start in your area APPROXIMATELY seven days from the date of this notice and will continue from [START DATE] until [END DATE]. Please be aware that there may be construction activities that cause traffic delays. [CONTRACTOR NAME] will make every effort to maintain normal traffic access and minimize disruption in your neighborhood. No Parking / Tow‐Away signs will be posted in affected areas two working days in advance of enforcement. Access to driveways will be maintained at ALL times during the construction. Prior to activities in your immediate area, you will be sent a notification TWO WORKING DAYS before work begins. [CONTRACTOR NAME] and the City of Cupertino, Department of Public Works, apologize for any inconvenience due to these activities. If you have any questions or need assistance as these activities progress, please call the number(s) listed below: [CONTRACTOR NAME] [NAME OF PROJECT MANAGER, CONTRACTOR) Project Manager (XXX) XXX‐XXXX (24-hour number) City of Cupertino (NAME OF CONSTRUCTION MANAGEMENT FIRM IF ONE) (PERSON’S NAME FROM CONSTRUCTION MANAGEMENT FIRM) (XXX) XXX‐XXXX (24-hour number) City Office: (408)777-3354 Department of Public Works Thank you for your patience and cooperation, [NAME OF PROJECT MANAGER, CONTRACTOR], Project Manager [NAME OF CONSTRUCTION FIRM] END OF SPECIAL CONDITIONS 2023 Concrete Reconstruction Project 2021 Form Technical Specifications 2023-104 Page 83 TECHNICAL SPECIFICATIONS PART 1 – GENERAL 1.01 DESCRIPTION The work to be done is maintenance type work and consists, in general, of the removal and replacement of existing portland cement concrete curb & gutters, sidewalks, driveway approaches, accessible ramps, median curbs, asphalt replacement adjacent to portland cement concrete work, flat work, and tree root barriers, as required. The work may also include the removal and replacement of valley gutters, installation of new accessible curb ramps and median island flatwork as noted. The majority of the work consists of removal and replacement of portland cement concrete curb & gutter and sidewalk where drainage problems exist or where displacements may become a public safety hazard. The improvements will be replaced over existing base material in most cases (approximately 50% of sidewalk replacement locations). When it is necessary to remove pavement adjacent to the lip of the gutter, replacement of asphalt concrete pavement will be completed by the Contractor. Contractor shall complete all work in conformance with Sections 39, 73, 92 and 94 of the State of California, Department of Transportation, Standard Specifications latest edition. 1.02 MATERIALS PORTLAND CEMENT CONCRETE: Portland Cement Concrete shall be Class A concrete have one (1”) inch maximum combined aggregate grading, conforming to Section 90- 1.02C(4)(d) of the Standard Specifications. Concrete shall contain not less than six (6) sacks (564 pounds) of cementitious material per cubic yard. PORTLAND CEMENT: All cement used shall be of one brand and shall conform to A.S.T.M. C150 Type II Supplementary Cementitious Materials shall conform to Section 90- 1.02B(3). Results of certified tests made by recognized testing laboratory shall be furnished by the cement manufacturer on request of the Engineer AGGREGATES: Aggregates for portland cement concrete shall conform to Section 90-2.02C of the State of California, Department of Transportation, Standard Specifications latest edition. Combined aggregate grading shall conform to the one (1”) inch maxi mum requirements of Section 90-1.02C(4)(d) of the State of California, Department of Transportation, Standard Specifications latest edition. 2023 Concrete Reconstruction Project 2021 Form Technical Specifications 2023-104 Page 84 WATER: Water for washing aggregates and for mixing portland cement concrete shall conform to Section 90-1.02D of the State of California, Department of Transportation, Standard Specifications latest edition. ADMIXTURES: No admixtures, accelerators, or retarders shall be allowed without the express approval of the Engineer. EXPANSION JOINTS: Expansion joints shall consist of prepared strips of three-eighths (3/8”) inch thick premolded joint filler conforming to the specifications of A.S.T.M. Designation: D-1751. CURING: All portland cement concrete surfaces shall be cured using a portland cement concrete curing compound No. 4 or 5 meeting the requirements of State of California, Department of Transportation, Standard Specifications Section 90- 1.03B(3)(b)of the latest edition of the State of California Standard Specifications. HOT MIX ASPHALT (HMA) REPLACEMENT: This work shall conform to Section 39, HOT MIX ASPHALT, Section 92, ASPHALTS, and Section 94, ASPHALTIC EMULSIONS of the State of California, Department of Transportation, Standard Specifications latest edition, with the exceptions noted in these Provisions. The HMA shall be ½” Type A with PG 64-10, The work shall include sawcutting and/or grinding of asphalt, removal of asphalt and affected subgrade and replacement of asphalt as specified in these Provisions and as directed by the Engineer. Prior to starting work, the Contractor shall submit Job Mix Formula on CEM 3511 and 3512 forms. A CEM 3513 is not required. CERTIFICATES OF COMPLIANCE: Contractor shall furnish to the Engineer a Certificate of Compliance signed by the manufacturer of the plant mix portland cement concrete and Hot Mix Asphalt. Certificate of Compliance shall state that the portland cement concrete and asphaltic cement concrete furnished complies in all respects with the requirements of the specifications. A Certificate of Compliance shall be furnished with each lot of material delivered to the work and the lot so certified shall be clearly identified in the Certificate. 1.03 TRAFFIC CONTROL AND PEDESTRIAN SAFETY The Contractor shall provide traffic control in the form of placing warning signs, markers and devices in accordance with the California MUTCD (latest edition) and as required by the Engineer. When necessary to provide for 2023 Concrete Reconstruction Project 2021 Form Technical Specifications 2023-104 Page 85 public safety or convenience, either for vehicles, pedestrians or bicyclist, the Contractor shall provide flaggers as necessary. During non-work hours, the Contractor shall post signs and warning devices to safely direct pedestrians and bicyclist around the work are. See Traffic Control Specifications for additional requirements. Contractor shall not unnecessarily interfere with use of any roadway, walkway or other facility for vehicular or pedestrian traffic. Before beginning any interference and only with City’s prior concurrence, Contractor may provide detour or temporary bridge for traffic to pass around or over the interference, which Contractor shall maintain in satisfactory condition as long as interference continues. Unless otherwise provided in the Contract Documents, Contractor shall bear the cost of these temporary facilities. 1.04 CONSTRUCTION METHODS SUBGRADE PREPARATION: (Portland Cement Concrete & Asphaltic Concrete) The existing material shall be excavated to the required depth per the City of Cupertino Standard Details or Caltrans Standard Plans (latest edition), as is applicable. The finished subgrade immediately prior to placing subsequent material thereon shall have a relative compaction of ninety (90%) percent for a depth of 0.5 foot as determined by State of California Test Method No. 216. The subgrade shall be smooth and true to the required grade. Immediately prior to the placing of cushion for portland cement concrete, the subgrade shall be thoroughly saturated with water. Ponded water shall not be permitted. CUSHION: The base material underlying existing sidewalk, curb and gutter or other portland cement concrete improvements is considered acceptable for this work. The Contractor will be required to bring the material to the proper grade and to consolidate by watering. The project engineer will determine when the required moisture content has been obtained. If additional cushion material is required due to grade changes, base material uncontaminated by native soil from other locations or ¾” Class 2 aggregate base may be used. FORMS: Forms shall be smooth on the side placed next to the portland cement concrete, and shall have a true smooth upper edge and shall be sufficiently rigid to withstand the pressure and tamping of fresh portland cement concrete without distortion. Timber forms shall be free from warping of deformation. All forms shall be thoroughly cleaned and coated with form oil to pr event the portland cement concrete from adhering to them. The depth of forms for back of curbs shall be equal to the full depth of the curb. The depth of face forms for portland cement concrete curbs shall be equal to the full face height of the curb. The gap between the bottom of the form and the subgrade shall not exceed 1 inch. Forms shall be set carefully 2023 Concrete Reconstruction Project 2021 Form Technical Specifications 2023-104 Page 86 to alignment and grade and shall be held rigidly in place by stakes, spreaders, or clamps, and shall be braced so that no displacement will occur during the working of the portland cement concrete. For other than short radius curves, timber forms shall be nominal two (2”) inch stock. All concrete placement shall be confined and no neat (earth confined) placement shall be allowed. When allowed by the engineer, concrete may be placed neatly against asphaltic concrete. PLACEMENT: All portland cement concrete shall be used while fresh and before it has taken an initial set. Retempering any partially hardened portland cement concrete with additional water shall not be permitted. Where pavement or surfacing is to be placed around or adjacent to manholes, drop inlets, or catch basins, which will be located within traffic lanes, such structures shall not be constructed to final grade until after the pavement or surfacing has been placed around these locations. Portland cement concrete shall be poured continuously between joints and brought to the required section as the work progresses. JOINTS (CURB AND GUTTER): Expansion joints shall be installed at each side of structures and at the ends of curb returns. Weakened plane joints shall be constructed at ten (10’) foot maximum intervals. Weakened plane joints shall be cut to a minimum depth of one and one-fourth (1-1/4”) inch with a tool that leaves corners rounded and insures a free movement of the portland cement concrete at the joint. The joint shall have a minimum width of one-eighth (1/8th) inch and shall not exceed one-fourth (1/4”) inch. JOINTS (SIDEWALK): Expansion joints shall be constructed at all returns and opposite expansion joints in adjacent curb. Where curb is not adjacent, expansion joints shall be constructed at intervals of sixty (60’) foot maximum intervals and opposite weakened plane joints in adjacent curb. Joints shall be constructed at right angle to the line of curb and to the same depth and width as for curb and gutter. Score lines shall be constructed at five (5’) foot intervals at right angle to the line of curb. For sidewalk eight (8’) feet or over in width, a score line parallel to the line of curb shall be constructed midway between back of curb and back of walk. Score line shall be made with a scoring tool which will make a rounded line of uniform width and depth of one-fourth (1/4”) inch. A score line parallel to the face of curb shall be constructed six (6”) inches from the face of the curb. TOLERANCE: The top and face of the curb and gutter, the flowline of the curb and gutter, and the surface of the sidewalk shall not vary more than one-fourth (1/4”) inch 2023 Concrete Reconstruction Project 2021 Form Technical Specifications 2023-104 Page 87 for the edge of an eight (8’) foot straight edge when placed against the surface, except at grade changes or curves. FINISH: Fresh portland cement concrete shall be struck off and compacted until a layer of mortar has been brought to the surface. The surface shall be finished to grade and cross section with a float, troweled smooth, and finished with a broom. The finish and texture of the portland cement concrete shall be approved by the Engineer. Portland cement concrete adjacent to expansion joints shall be finished with an edger tool. Brooming shall be transverse to the line of traffic. HMA PLACEMENT: All asphalt replacement area finish surfaces must be smooth, uniform and match existing grades. Application of asphalt and asphaltic emulsion must be neat, with surrounding areas kept clean. Asphalt replacement thickness shall be 6 inches. The HMA shall be placed in two lifts with the top lift no less than 1-3/4 inches thick. The HMA shall be placed using the Method Specification for compaction as amended in writing by the Engineer prior to the work. Any broken edges of existing pavement shall be sawcut immediately prior to paving. Tack coat shall be placed on the vertical edges of both the existing HMA and concrete prior to the base course paving and again prior to the paving of the surface course. 1.05 TREE ROOTS & TREE DAMAGE Contractor shall notify the Engineer of any roots discovered which are larger than two inches in diameter. No root larger than 2 inches in diameter shall be removed without expressed permission from the City Engineer and the Tree/Right of Way Supervisor (Jonathan Ferrante 408.777.3343). Where work occurs adjacent to or over tree roots, the roots shall be removed to a minimum depth of six inches (6") below the bottom or side of the new portland cement concrete. Root removal shall be achieved by mechanical root pruning, supersonic air tool root pruning, or approved equal. Cuts on tree roots and barks or skins or cuts on trees shall be treated with an acceptable sealer and growth inhibitor such as Tre-hold. Payment for this work shall be considered as included in the price for removal and replacement. 1.06 ROOT BARRIER Linear root barriers shall be used when concrete hardscape is placed within six feet (6’) of any tree in any direction. Eighteen inch root barriers shall be used when tree is located adjacent to new curb and gutter. All root barriers shall be made of high density, high impact plastic, shall have a minimum thickness of 0.085” and shall be installed according to manufacturer’s specifications. The length of the root barrier shall extend five times the diameter of the tree trunk each direction measured from the centerline of the tree’s trunk or, entire length of repair, whichever is less. 2023 Concrete Reconstruction Project 2021 Form Technical Specifications 2023-104 Page 88 1.07 REMOVAL OF PARK STRIP IMPROVEMENTS At some curb ramp locations, it will be necessary to remove existing concrete improvements made by property owners in the public right of way. If such removals are necessary, the limit of removal shall be sawcut to full depth of the existing concrete. After removal and construction of the new concrete facilities, the remaining area shall be backfilled with topsoil approved by the Engineer. 1.08 EXISTING IMPROVEMENTS Where irrigation systems, landscaping, fences, mailboxes, signs, and other improvements exist adjacent to the work, the Contractor shall use reasonable caution to ensure that no damage is caused. If damage to these improvements does occur, the Contractor shall replace in kind or with an acceptable substitute, at his expense. When repairs to sidewalks and driveways adjacent to property line occur, there may be instances where on-site flat work (driveways and walkways) on private property will: 1. Interfere with the repair of existing public improvements. 2. Be incompatible with the new sidewalk, curb and gutter grades. 3. Be out of repair to the extent that the hardscape is hazardous to pedestrian traffic. 4. Present a restriction to the street tree's natural growing space. In these situations, it may become necessary for the City's Contractor to remove and replace portions of the on-site flat work. The costs for the removal and replacement of private portland cement concrete improvements will be paid at contract unit prices. The costs for removal and replacement of private improvements other than portland cement concrete and/or asphalt will be negotiated on a case by case basis with the Engineer. On-site removal and replacement will be only as directed by the Engineer and no extension of quantities will be allowed without prior approval. For decorative hardscape and landscape areas (parkstrip portland cement concrete, mow strips, etc.) the cost for the replacement of voluntary and private improvements within the public right-of-way shall remain the sole responsibility of the abutting property owner. In no instance shall the replaced hardscape be within three (3) feet of the base of any street tree, or in any way present a restriction to the natural growth of the street tree,or interfere with any public utility within the parkstrip. All such work shall require a permit from the City of Cupertino separate from this project. 1.09 CLEANUP AND BACKFILLING 2023 Concrete Reconstruction Project 2021 Form Technical Specifications 2023-104 Page 89 The construction area shall be kept neat and safe. Forms shall be removed from the edge of portland cement concrete within two (2) days and be kept in neat piles, not scattered about, and nails in boards shall be turned under, bent over, or removed. Removed nails shall be cleaned up and removed from site. After forms are removed, portland cement concrete edges shall be backfilled and raked smooth with clean and suitable topsoil. Said topsoil material shall also be used to backfill and bring to an acceptable grade area where portland cement concrete or other paving material is removed, but not replaced. The Contractor shall clean all areas occupied by him in connection with the work, and the entire area shall be left in a neat, clean and presentable condition, within seven days of completion. All asphalt replacement shall be completed, brought to finish grade with asphaltic concrete within thirty (30) calendar days of removal. Upon removal of forms, all edges of concrete are to be backfilled. When the edge is lip of gutter, backfill material will be compacted class II aggregate base or asphalt concrete. Any residue left from said cutting operations shall be cleaned and removed per the nonpoint source pollution control best management practices. All cleanup shall be performed as required by the Engineer. 1.10 WORK AREAS The Engineer, whenever possible, will arrange the work so that all of the work required to be done in a section of the City will be scheduled continuously. However, curb ramps and curb and gutter work on streets to be paved in 2023 will be first priority. The majority of work items will occur on various residential streets throughout the City with parking on either side of the street and a 25 miles per hour speed limit. All other work will occur on arterial / collector streets. These streets include, but are not limited to: • De Anza Blvd. • McClellan Rd • Homestead Rd • Stelling Rd • Stevens Creek Blvd 1.11 PAYMENT: Payment shall be per unit specified and shall be considered full compensation for furnishing all materials, equipment, labor, safety, traffic controls, cleanup and all work incidental thereto. Bid items 1 through 3, shall include: sawcutting, removal and replacement of existing concrete; doweling per City Standard Detail 1-23, removal of street pavement as necessary; replacement or repair of existing improvements; grading, filling and consolidating of base materials; tree and root pruning; and 2023 Concrete Reconstruction Project 2021 Form Technical Specifications 2023-104 Page 90 backfill and cleanup. Contractor is advised to closely review City of Cupertino Standard Details 1-16, 1-18 through 1-30. See city standard detail 1-20 for diagram of pay items. Bid Item 4 – Removal of Park Strip Improvements: This work includes breaking up, loading, hauling and disposing of portland cement concrete, asphalt, brick or other materials in areas such as park strips where new portland cement concrete is not to be installed. This work shall also include backfilling and smoothing out topsoil to a plane even with top-of-curb and top- of-sidewalk. Bid Item 5 - Valley Gutter: This work shall include the removal of existing valley gutter, removal of street pavement if necessary, grading, filling and compaction of both sub-base and base material if necessary and construction of new valley gutter. Portland cement concrete shall be as specified above and shall include #4 rebar per City Standard Detail 1-18. Bid Item 6A – 6G – Depressed Curb Ramps: This work shall include sawcut and removal of existing improvements, the construction of sub-grade, placement of cushion material and construction of new handicap ramp at various locations per Caltrans Standard Detail A88A (latest addition) and in conformance with ADA requirements. The Engineer shall determine the type of ramp to be installed at each location. Work shall include all improvements within ramp boarders (including adjacent curb & gutter) as s hown on detail A88A, assuming planter width ranging 4.5’ to 5.0’. Payment shall be on per each basis. Case type B shall have a maximum area of 200 square feet. If a type B ramp exceeds 200 square feet, the additional square footage will be paid at the unit cost for removal/replacement of sidewalk. Depressed curb ramps shall be poured monolithically with adjacent curb and gutter, retaining curbs, etc. All improvements outside of the ramp borders including sidewalk, curb and gutter, and retaining curbs behind walk (case type B, and C) shall be paid at unit cost. Retaining curbs adjacent to planting areas (Case Type E, F & G) shall be included in unit cost to construct ramp. See attached detail A88A for illustration of pay items. Hardscape in planter strip adjacent to curb ramps shall be removed to limits specified by engineer prior to installation of ramp, and shall be paid per bid item 4. The detectable warning surface shall be dark gray in residential neighborhoods, the detectable warning service shall be federal yellow on arterial streets, collector streets, commercial areas, and in proximity to schools. Color will be specified by the Engineer. Bid Item 7 – Upgrade Existing Curb Ramp: This work will modify existing ramps to comply with Caltrans Standard Detail A88A (latest addition). Work shall include installation of detectable warning surfaces. Contractor shall verify existing ramps meet all ADA requirements, other than presence of detectable warning surface, prior to installation. The detectable warning surface shall extend the full width and three foot depth of the ramp and shall be located 6” to 8” from the gutter flowline. The detectable warning surface shall be federal yellow, as specified by the City Engineer, composite tactile by ADA solutions, Inc. or approved equal. When the detectable warning surface edge is cut and the resulting edge is not flush with the surface of the ramp, the edge shall be beveled or conformed with perimeter sealant at 1:2 max 2023 Concrete Reconstruction Project 2021 Form Technical Specifications 2023-104 Page 91 slope in accordance with the manufactures requirements. Color Matched structural adhesive shall be Urethane Elastomeric Adhesive by Bostik or approved equal. Structural adhesive shall be applied to full perimeter and through center of tile each way per manufactures requirements. Color matched, stainless steel 304, flat head drive anchors (1/4” diameter x 1 ½” long) shall be placed twelve inch on center both directions. Manufacturer(s) shall provide a written 5-year warranty for prefabricated detectable warning surfaces, guaranteeing replacement when there is a defect in the dome shape, color fastness, sound-on-cane acoustic quality, resilience, or attachment. Warranty period shall begin upon acceptance of work. Bid Item 8 – Curb Ramp Retaining Curb (behind walk): Payment shall be made per linear foot of retaining curb installed. Payment shall include full compensation for furnishing all labor, materials, tools, equipment, and incidentals. Bid Item 9 - Root Barriers: Payment shall be made per linear foot of root barrier installation. Payment shall include excavating the required trench, and the furnishing of all labor, materials, tools, and equipment required to root prune, apply dressing, and install root barrier complete and in place. Bid Item 10 - Median Island Curb: Payment shall include removal of existing improvements; removal of street pavement if necessary; grading, filling and consolidating of base materials. This work shall also include backfilling and replacement of topsoils in landscape median islands; protection in place or replacement of existing irrigation facilities (reconfiguration or modification of irrigation facilities if needed will be done by others); contractor shall supply traffic control and advance warning devices for lane closures. Payment shall be measured and paid per linear foot for median island curbs per City Standard Detail A1-8. Payment shall include full compensation for furnishing all labor, materials, tools, equipment, and incidentals, and for returning serviceable existing segmented curbs to the City or disposing of non-serviceable existing curbs. Locations of median islands improvements shall be determined by the Engineer. Payment shall include full compensation for furnishing all labor, materials (including sand cushion), tools, equipment, and incidentals. City will be responsible for relocation of any traffic control post/signs that may be located within median islands. Bid Item 11 - Reconstruction of Catch Basin Top: Payment shall be made for the removal and replacement of existing catch basin top per City Standard Detail 3-2; existing hood, frame and grate shall be salvaged and reused; replacement of existing rebar shall be included in the Bid Item. Bid Item 12 – Asphalt Replacement: Payment shall be measured and paid per the theoretical weight, measured in tons. The theoretical weight will be calculated based upon the individual asphalt replacement areas marked by 2023 Concrete Reconstruction Project 2021 Form Technical Specifications 2023-104 Page 92 the City, multiplied by the depth, multiplied by the weight of asphalt in lb/cubic feet (assume 148 lbs/cubic foot), all divided by 2000. Payment shall include full compensation for furnishing all labor, materials, tools, equipment, and incidentals, and for doing all the work involved in constructing the asphalt repairs, complete in-place, sawcutting, removal of asphalt/baserock/earth spoils, including any and all additional work described in these project specifications and plans. Any and all removal and replacement done outside of the areas marked by the City or to depths greater than the required 6 inches. Contractor is required to coordinate construction with Kane Wolfe, Public Works Inspector (408) 777-3353 a minimum of 48 hours in advance. Payment shall be made for only those items shown on the bid schedule. Any item of work that is not shown on bid schedule, but is required by these specifications shall be considered as incidental and full compensation for same shall be made as considered included in the payment for the bid items. In general, contract prices and payments shall include, but not be limited to, full compensation for all necessary materials, labor, tools, equipment, traffic control, and incidentals to do all the work involved, complete and in place, as shown on the plans, as specified in the specifications and as directed by the Engineer. LIST OF DETAILS Detail No. Title 1-16 STANDARD CURB SECTIONS 1-18 STANDARD VALLEY GUTTER 1-19 SIDEWALKS DETAILS 1-20 DRIVEWAY DETAIL – DETACHED SIDEWALK 1-21 DRIVEWAY DETAIL – MONOLITHIC SIDEWALK 1-21B DRIVEWAY DETAIL – MONOLITHIC SIDEWALK OPTION 2 1-23 DOWEL CONNECTIONS 3-2 STANDARD DROP INLET – CURB OPENING A88A CALTRANS REVISED STANDARD PLAN – CURB RAMP DETAILS 2023 Concrete Reconstruction Project 2023-104 Standard Details Page 98 STANDARD DETAILS 2023 Concrete Reconstruction Project 2021 Form Traffic Control Specifications 2023-104 Page 93 TRAFFIC CONTROL SPECIFICATIONS The Contractor shall submit traffic control plans to the Engineer for approval five (5) working days prior to the pre-construction meeting. Traffic control plans shall conform to the requirements in item number 20 below. All cost and expense for traffic control shall be included in the bid prices for various bid items and no special compensation shall be allowed. 1. The Contractor shall conduct operations and schedule cleanup so as to cause the least possible obstruction and inconvenience to traffic, pedestrians, cyclists and adjacent property owners. All work areas shall be swept clean at the end of each day’s work and at other times when directed by the Engineer. A mobile street sweeper shall be used wherever practical and dust shall be suppressed to the satisfaction of the Engineer. 2. The Contractor shall protect open excavations, trenches, and such during construction with fences, covers, and railings as required, together with signs, lights, and other warning devices sufficient to maintain safe pedestrian, bicycle and vehicular traffic to the satisfaction of the Engineer. No open excavations will be allowed over Saturday or Sunday. 3. Damage done by the Contractor during the course of the work to adjacent City, public or private property shall be repaired in kind, or as directed by the Engineer, at the Contractor’s expense. This includes the repair of traffic loop detectors, striping, signing, curb markings, etc. Loop detectors must be repaired within one week of the damage. 4. The work of restoration, including backfilling, repair of existing systems (irrigation, etc.), transitioning to existing improvements and cleanup, at each location, shall be diligently pursued to completion and no location shall the work be left partially completed for more than seven working days. 5. The Contractor's employees are subject to all parking regulations in effect in the City of Cupertino. 6. The Engineer shall have the right to limit the amount of removed concrete which may be opened or partly opened at any time. No more than 300 feet of removed concrete shall be left open at any one time. 7. All excavations must be backfilled or properly delineated for pedestrian / vehicle traffic at the end of each work day. 8. The Contractor shall not remove the barricades in the street at any given location until the asphalt concrete patching adjacent to the gutter has been done and a hazard to bicycles, pedestrians and motorists no longer exists. 2023 Concrete Reconstruction Project 2021 Form Traffic Control Specifications 2023-104 Page 94 9. Spillage resulting from hauling operations along or across any public traveled way shall be removed immediately by the Contractor at his expense. 10. The Contractor shall place barricades 50 feet on center at the gutter joints and provide one working flasher for each barricade and shall insure that each flasher is maintained in working condition while in use. The Contractor shall not remove the barricades in the street at any given location until the asphalt concrete patching adjacent to the gutter has been done and the hazard to bicyclists and motorists no longer exist. 11. Contractor shall maintain access to all driveways except when actually doing construction within the driveway boundaries, at which time partial access will be maintained unless alternate arrangements can be made with the property owners or tenants in advance. If the driveway to any garage or parking area is to be closed for construction work, prior written approval must be obtained from the property owners and the Engineer. Notice shall be posted by the Contractor 72 hours in advance stating the approximate time the driveway will be closed and reopened. 12. City of Cupertino Truck Routes shall be used for all hauling. Hauling within 500’ of any public school is prohibited between 7:00 AM and 9:30 AM and 2:00 PM to 4:00 PM. Contractor is responsible for identifying locations of schools and planning haul routes accordingly. 13. Contractor shall obtain a Transportation permit from the Public Works Department for any vehicle which exceeds weight or dimensions prescribed in the California Vehicle Code. 14. The Contractor shall supply, place, and maintain all necessary traffic control devices during construction in accordance with the applicable requirements of the City of Cupertino, the California Manual of Uniform Traffic Control Devices, and the traffic control plans approved by the City. 15. All traffic control devices shall conform to Section 12 of the Caltrans Standard Specifications. They are to be in good condition and sufficiently clean so as to be easily visible to traffic. All signs shall be placed in positions where they convey their message most effectively or as shown on the approved traffic control plan. 16. Signs to be used for traffic control shall conform to the requirements of the California Manual of Uniform Traffic Control Devices. Signs that are attached to existing poles shall not cause any damage to the poles when they are attached or removed. All of the hardware that is used when attaching signs to existing poles shall be completely removed from the poles when the signs are removed. If a construction sign is required in an area where it cannot be attached to an existing pole, it shall be attached to a 4” x 4” wooden pole. The distance from the ground surface to the bottom of the sign shall be seven (7) feet. 2023 Concrete Reconstruction Project 2021 Form Traffic Control Specifications 2023-104 Page 95 17. A flag-type high level warning device with three or more flags shall be used for each direction of traffic affected, generally placed within the taper area. 18. Flashing arrow boards shall be Type A or Type II as described in Section 6F.56 of the California Manual of Uniform Traffic Control Devices. Flashing arrow boards are required for lane shifts and reductions and may be required for nighttime work. 19. Dated “No Parking Tow Away” signs shall be posted a minimum of 72 hours in advance of all work requiring that cars not be parked on the street. Date and time of work shall be written on signs in two-inch-high letters with a ¼-inch felt black marker. Signs shall be posted 50 feet on center and removed immediately after the work is completed. The Contractor must notify the project inspector with locations of posting to verify seventy-two (72) hour notice. 20. Traffic Control Plans. A traffic control plan consistent with the following generally applicable conditions must be approved by the Public Works Department prior to the pre- construction meeting. The Contractor shall supply, place, and maintain all necessary traffic control devices in accordance with the California Manual of Uniform Traffic Control Devices and the following conditions: • Traffic control plans will include a schedule of construction showing each phase of work and the anticipated method of handling traffic for each phase. Traffic control plans will include a scaled drawing of the street, lane configuration, parking, sidewalk, work area, and the location of signs and cones, etc., to warn, direct, and guide the traffic. For all major intersections, the traffic control plan shall reflect actual (not typical) intersection layout and indicate islands, medians, lane lines, bike lanes, nearby driveways, and note all pavement and lane widths. • In general, Contractor shall maintain all vehicular, pedestrian, and bike movements. No total closure of any arterial or collector street will be permitted. City may allow closure of local residential streets but Contractor shall always maintain local and emergency access. • The Contractor shall maintain one lane of traffic in each direction at all times on all streets. The clear width of the lane shall be a minimum of 10 feet. • A minimum four feet clear sidewalk shall be maintained unless the work makes closure unavoidable, in which case the sidewalk may be closed while working, subject to the approval of the Engineer. However, an alternate pedestrian facility must be provided for the duration of the closure. At intersections, work will be permitted at one corner at a time so pedestrian movements can be maintained through the intersection. 21. Work shall not restrict visibility of any traffic control device. 2023 Concrete Reconstruction Project 2021 Form Traffic Control Specifications 2023-104 Page 96 22. No work will be permitted within 1500 feet of school grounds until after 9:30 a.m. on school days. Other special restrictions may be required at heavily used school crossings or school commute routes beyond 1500 feet from the school grounds as deemed necessary for student safety by the Engineer. 23. No closure of lanes on arterial and collector streets will be permitted between the hours of 7 and 9 a.m. and 3:30 and 7 p. m. 24. If work will impact transit stops or transit routes, Contractor shall be required to contact Santa Clara Valley Transportation Authority or other affected transit companies to address relocation of facilities or rerouting of buses prior to submitting traffic control plan. Traffic control plan should indicate what actions are being taken with regard to transit services. 25. Any work within 150 feet of any signalized intersection should be coordinated with the Traffic Signal Technician at (408) 777-1366. 26. All signs and other warning devices shall be provided by the Contractor and shall become his property after completion of the Contract. The cost of providing, installing and maintaining signs, lights, caution tape, delineators, flares, barricades and other facilities as directed by the Engineer for the convenience and direction of public traffic shall be included in the prices paid for the various items of work involved in the project. 27. The above requirements are a minimum and do not limit the Contractor’s responsibility of doing all that is practical and necessary to ensure the safety of workers, pedestrians, bicyclists, and motorists. The Contractor shall conform to the above traffic control requirements which are generally applicable to most common situations. Based on the nature of a job, additional conditions or exceptions to the above conditions may be necessary. "/ "/ "/"/ 0 1,500 3,000 4,500 6,000750Feet !"#$280 STEVENS CREEK BLVD. (SCB) btwn BUBB RD. & FOOTHILL BLVD. NO TRUCKS ANYTIME Foothill Blvd. Underpass N/B 15'-2" Foothill Blvd. Underpass S/B 15'-4" ·|}þ85 MCCLELLAN RD btwn CLUB HOUSE LANE & TRESSLER CT NO TRUCKS ANYTIME All TRUCKS SHALL COMPLY WITH SECTION 11.32 OF THE CUPERTINO MUNICIPAL CODE DE A N Z A B L V D WO L F E R D FO O T H I L L B L V D TA N T A U A V E HOMESTEAD RD STEVENS CREEK BLVD MCCLELLAN RD FI N C H A V E BU B B R D Perimeter Underpass (Private) Vallco Square Clearance 10'-0" Wolfe Road Overpass (Pedestrian) Vallco Square Clearance 15'-0" SR 85 btwn Hwy 280 & 101 NO TRUCKS ANYTIME RAINBOW DR ST E L L I N G R D Legend "/Bridge - Low Clearence Designated Truck Route No Trucks > 3 Tons from 7 AM-9:30 AM or 2 PM-4 PM No Trucks Any Time CITY OF CUPERTINO TRUCK TRAFFIC RESTRICTIONS ± City Boundary 2.5 Contract (1) Final Audit Report 2023-05-31 Created:2023-05-30 By:City of Cupertino (webmaster@cupertino.org) Status:Signed Transaction ID:CBJCHBCAABAA9N_qUwXt8XGJzYpzA9WNaMoTNp6BxE0n "2.5 Contract (1)" History Document created by City of Cupertino (webmaster@cupertino.org) 2023-05-30 - 10:43:01 PM GMT- IP address: 98.97.57.92 Document emailed to Julia Kinst (juliak@cupertino.org) for approval 2023-05-30 - 10:47:16 PM GMT Document approved by Julia Kinst (juliak@cupertino.org) Approval Date: 2023-05-30 - 10:48:26 PM GMT - Time Source: server- IP address: 98.97.57.92 Document emailed to Araceli Alejandre (aracelia@cupertino.org) for approval 2023-05-30 - 10:48:31 PM GMT Document approved by Araceli Alejandre (aracelia@cupertino.org) Approval Date: 2023-05-30 - 11:04:48 PM GMT - Time Source: server- IP address: 73.170.27.253 Document emailed to Matt Ramirez (matt@rscminc.com) for signature 2023-05-30 - 11:04:53 PM GMT Email viewed by Matt Ramirez (matt@rscminc.com) 2023-05-30 - 11:09:47 PM GMT- IP address: 66.249.84.235 Document e-signed by Matt Ramirez (matt@rscminc.com) Signature Date: 2023-05-30 - 11:29:31 PM GMT - Time Source: server- IP address: 45.26.48.164 Document emailed to teera@rscminc.com for signature 2023-05-30 - 11:29:36 PM GMT Email viewed by teera@rscminc.com 2023-05-30 - 11:29:45 PM GMT- IP address: 66.249.84.230 Signer teera@rscminc.com entered name at signing as Teera Nuntaworanuch 2023-05-30 - 11:31:20 PM GMT- IP address: 45.26.48.164 Document e-signed by Teera Nuntaworanuch (teera@rscminc.com) Signature Date: 2023-05-30 - 11:31:22 PM GMT - Time Source: server- IP address: 45.26.48.164 Document emailed to christopherj@cupertino.org for signature 2023-05-30 - 11:31:27 PM GMT Email viewed by christopherj@cupertino.org 2023-05-30 - 11:32:33 PM GMT- IP address: 104.47.74.126 Signer christopherj@cupertino.org entered name at signing as Christopher D. Jensen 2023-05-30 - 11:32:57 PM GMT- IP address: 136.24.22.194 Document e-signed by Christopher D. Jensen (christopherj@cupertino.org) Signature Date: 2023-05-30 - 11:32:59 PM GMT - Time Source: server- IP address: 136.24.22.194 Document emailed to Pamela Wu (pamelaw@cupertino.org) for signature 2023-05-30 - 11:33:03 PM GMT Email viewed by Pamela Wu (pamelaw@cupertino.org) 2023-05-31 - 5:26:09 PM GMT- IP address: 104.47.73.126 Document e-signed by Pamela Wu (pamelaw@cupertino.org) Signature Date: 2023-05-31 - 5:26:25 PM GMT - Time Source: server- IP address: 64.165.34.3 Document emailed to Kirsten Squarcia (kirstens@cupertino.org) for signature 2023-05-31 - 5:26:31 PM GMT Email viewed by Kirsten Squarcia (kirstens@cupertino.org) 2023-05-31 - 5:44:32 PM GMT- IP address: 172.225.88.144 Document e-signed by Kirsten Squarcia (kirstens@cupertino.org) Signature Date: 2023-05-31 - 5:46:32 PM GMT - Time Source: server- IP address: 104.28.124.179 Agreement completed. 2023-05-31 - 5:46:32 PM GMT